KEGG   Mus musculus (mouse): 19072Help
Entry
19072             CDS       T01002                                 

Gene name
Prep, AI047692, AI450383, D10Wsu136e, PEP, Pop
Definition
(RefSeq) prolyl endopeptidase (EC:3.4.21.26)
  KO
K01322  
prolyl oligopeptidase [EC:3.4.21.26]
Organism
mmu  Mus musculus (mouse)
Pathway
Renin-angiotensin system
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04614 Renin-angiotensin system
    19072 (Prep)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.26  prolyl oligopeptidase
     19072 (Prep)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S9: prolyl oligopeptidase family
   19072 (Prep)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10 23.27 cM; 10 B2-B3
AA seq 710 aa AA seqDB search
MLSFQYPDVYRDETSVQEYHGHKICDPYSWLEDPDSEQTKAFVEAQNKITVPFLEQCPIR
GLYKERMTELYDYPKYSCHFKKGKRYFYFYNTGLQNQRVLYVQDSLEGEARVFLDPNTLS
DDGTVALRGYAFSEDGEYFAYGLSASGSDWVTIKFMKVDGAKELPDVLERVKFTCMAWTH
DGKGMFYNSYPQQDGKSDGTETSTNLHQKLCYHVLGTDQSEDILCAEFPDEPKWMGGAEL
SDDGRYVLLSIWEGCDPVNRLWYCDLQQEPNGITGILKWVKLIDNFEGEYDYVTNEGTVF
TFKTNRNSPNYRLINIDFTDPDESKWKVLVPEHEKDVLEWVACVRSNFLVLCYLHDVKNI
LQLHDLTTGALLKTFPLDVGSVVGYSGRKKDSEIFYQFTSFLSPGVIYHCDLTKEELEPM
VFREVTVKGIDAADYQTIQIFYPSKDGTKIPMFIVHKKGIKLDGSHPAFLYGYGGFNISI
TPNYSVSRLIFVRHMGGVLAVANIRGGGEYGETWHKGGILANKQNCFDDFQCAAEYLIKE
GYTSPKRLTINGGSNGGLLVAACANQRPDLFGCVIAQVGVMDMLKFHKFTIGHAWTTDYG
CSDTKQHFEWLLKYSPLHNVKLPEADDIQYPSMLLLTADHDDRVVPLHSLKFIATLQYIV
GRSRKQSNPLLIHVDTKAGHGAGKPTAKVIEEVSDMFAFIARCLNIEWIQ
NT seq 2133 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccttccagtaccccgacgtgtaccgcgacgagacctccgtgcaggagtatcat
ggacataaaatttgtgacccgtattcttggcttgaagacccagacagcgagcagactaag
gctttcgtggaggcacaaaacaagattactgtgccatttcttgagcaatgtccaatcaga
ggtttatacaaggagagaatgactgagctgtacgactaccccaagtacagctgccacttc
aagaaaggaaagcggtacttttatttttacaatacaggtttgcagaaccaacgcgtgtta
tatgtgcaagactccttagagggggaggccagagtgttcctggaccccaacacactgtcg
gatgatggtacagtggcactccgaggttatgccttcagtgaagatggcgaatactttgcc
tatggtctgagcgccagcggctccgactgggtgacgatcaagttcatgaaggtcgatggt
gccaaagagctcccggatgtgctggagagagtcaagttcacctgcatggcctggacgcat
gacgggaagggaatgttctataactcatacccgcagcaggacgggaagagcgatggcaca
gagacatccaccaatctccaccaaaagctctgctaccacgtcttggggacggatcagtca
gaagatattttgtgtgctgagttccccgatgagcctaaatggatgggaggagctgagcta
tccgacgatggccggtacgtcttgttatccatctgggagggatgtgatccagtaaaccga
ctgtggtactgtgacctccagcaagaacccaatggtatcaccggaatcctgaagtgggta
aaactgatagacaactttgaaggagaatacgactacgtaaccaacgagggcacagtgttc
acattcaagacgaaccgcaattctcccaattatcggctgatcaatatcgacttcacggac
cctgacgagtccaagtggaaagtgctcgtaccggagcacgagaaggatgtcttagaatgg
gtggcttgtgtcaggtccaacttcctggtcttgtgctacctccatgacgtgaagaacatt
ctacagcttcacgacctgacgactggtgctctcctcaagaccttccccctggatgtgggc
agcgtggtgggctacagtgggcgcaagaaggactctgagatcttctaccagttcacatcc
ttcctatctccaggtgtcatttaccactgcgatcttaccaaagaggaactggagcccatg
gttttccgagaggtgacggtgaagggaatcgatgctgctgattaccagacaatccagatt
ttctaccctagcaaggatggcaccaagattcccatgtttattgtgcataaaaaaggcata
aagctggatggctcacaccctgctttcttatatggctacgggggcttcaacatctccatt
acacccaactacagcgtgtccaggctcatttttgtgagacatatgggcggcgtcctcgcg
gtggctaacatcagaggcggcggtgaatacggagagacgtggcacaaaggtggtatcttg
gccaacaaacagaactgttttgatgacttccagtgtgctgctgagtacctcatcaaggaa
ggttacacatctcccaagaggctcacgatcaacggaggctccaacggcggcctcttagta
gctgcttgcgcaaatcagcgtccagacctcttcggctgtgttattgcccaggttggagtg
atggacatgttgaagttccacaaatttactatcggccatgcatggaccactgattacggg
tgctccgacactaaacaacactttgaatggcttctcaaatactcgccactacacaatgtg
aagcttccggaggcagacgacatccagtacccgtccatgcttctcctcacggctgaccac
gacgaccgcgtggtcccgctgcactcactgaagttcattgccacccttcagtacatcgtg
ggccgcagccggaagcagagcaaccccctgctcatccacgtggacaccaaggccggccac
ggggccgggaaacccaccgccaaagtgatagaagaagtctcggatatgtttgcgttcata
gcacggtgcctgaacatcgagtggatccagtaa

DBGET integrated database retrieval system