KEGG   Mus musculus (mouse): 19082Help
Entry
19082             CDS       T01002                                 

Gene name
Prkag1, AA571379, BB036179, Prkaac
Definition
(RefSeq) protein kinase, AMP-activated, gamma 1 non-catalytic subunit
  KO
K07200  
5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Apelin signaling pathway
Tight junction
Circadian rhythm
Insulin signaling pathway
Adipocytokine signaling pathway
Oxytocin signaling pathway
Glucagon signaling pathway
Insulin resistance
Non-alcoholic fatty liver disease (NAFLD)
Hypertrophic cardiomyopathy (HCM)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04371 Apelin signaling pathway
    19082 (Prkag1)
   04068 FoxO signaling pathway
    19082 (Prkag1)
   04152 AMPK signaling pathway
    19082 (Prkag1)
 Cellular Processes
  Cellular community - eukaryotes
   04530 Tight junction
    19082 (Prkag1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    19082 (Prkag1)
   04922 Glucagon signaling pathway
    19082 (Prkag1)
   04920 Adipocytokine signaling pathway
    19082 (Prkag1)
   04921 Oxytocin signaling pathway
    19082 (Prkag1)
  Aging
   04211 Longevity regulating pathway - mammal
    19082 (Prkag1)
   04213 Longevity regulating pathway - multiple species
    19082 (Prkag1)
  Environmental adaptation
   04710 Circadian rhythm
    19082 (Prkag1)
 Human Diseases
  Cardiovascular diseases
   05410 Hypertrophic cardiomyopathy (HCM)
    19082 (Prkag1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19082 (Prkag1)
   04931 Insulin resistance
    19082 (Prkag1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 F1; 15 54.73 cM
AA seq 330 aa AA seqDB search
MESVAAESSPALENEHFQETPESNNSVYTSFMKSHRCYDLIPTSSKLVVFDTSLQVKKAF
FALVTNGVRAAPLWDSKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVY
LQDSFKPLVCISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLQELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVVDEKGRVVDIY
SKFDVINLAAEKTYNNLDVSVTKALQHRSHYFEGVLKCYLHETLETIINRLVEAEVHRLV
VVDEHDVVKGIVSLSDILQALVLTGGEKKP
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atggagtcggttgctgcagagagctcgccagctctagagaatgaacactttcaagagacc
ccggaatcaaacaatagtgtgtatacttccttcatgaagtctcatcgctgctatgaccta
attcccacaagttccaagttggtggtatttgacacttcgctacaggtaaagaaagccttt
tttgccctggtgaccaatggtgttcgtgccgcccctttgtgggacagtaagaagcagagt
tttgtgggcatgctgaccatcaccgacttcatcaacattttgcaccgatactataagtca
gccctggtgcagatctacgaactggaggagcacaagatagagacgtggagagaggtgtac
ctgcaggactcctttaagccacttgtctgcatctctccaaatgccagcttgtttgatgct
gtctcttcattaattcgaaataagatccacaggctcccagttatcgacccagagtcaggc
aacaccttgtacatccttactcacaagcggatcctcaagttcctcaagttgtttatcacc
gagttccccaagccggaattcatgtctaagtctctccaagagctgcagattggcacctat
gccaatattgccatggtccgtactaccacgcctgtctacgtggctctgggcatctttgta
cagcaccgagtctccgccttacctgtagtggatgagaaagggcgtgtggtggacatctac
tccaagtttgatgtgatcaatttggcagccgaaaagacctacaacaacctagatgtgtct
gtgacaaaagccctgcagcatcggtcccactactttgagggtgttctcaaatgctacctg
catgagactctggaaaccatcatcaataggctggtggaggcagaggttcaccgtctggtg
gtggtggatgaacacgacgtggtcaagggcatcgtttcgctgtctgacatcttacaggct
ctggtgctcacgggtggagagaagaagccctga

DBGET integrated database retrieval system