KEGG   Mus musculus (mouse): 19088Help
Entry
19088             CDS       T01002                                 

Gene name
Prkar2b, AI451071, AW061005, PKARIIbeta, Pkarb2, RII(beta)
Definition
(RefSeq) protein kinase, cAMP dependent regulatory, type II beta (EC:2.7.11.1)
  KO
K04739  
cAMP-dependent protein kinase regulator
Organism
mmu  Mus musculus (mouse)
Pathway
Insulin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    19088 (Prkar2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
12; 12 B1
AA seq 416 aa AA seqDB search
MSIEIPAGLTELLQGFTVEVLRHQPADLLEFALQHFTRLQQENERKGAARFGHEGRTWGD
AGAAAGGGIPSKGVNFAEEPMRSDSENGEEEEAAEAGAFNAPVINRFTRRASVCAEAYNP
DEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVI
DQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPG
ALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQ
IIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRA
ASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDIVEPTA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcgagatccccgcggggctcacggagctgctgcagggcttcacggtggaggtg
ctgaggcaccagcccgccgacctgctggagttcgcgctgcagcacttcacgcggctgcag
caggagaacgagcgcaagggcgccgcgcgcttcggccatgagggcaggacctggggggac
gcgggcgcagccgccgggggcggcatccccagtaagggtgtcaacttcgccgaggagccc
atgcgctccgactccgagaacggcgaggaggaggaggccgcggaagcaggggcgttcaac
gctccagttataaaccggttcacaaggcgtgcctcggtctgtgcagaagcttataatcct
gatgaagaggaagacgatgcagagtccaggataatacatcccaaaaccgatgatcagaga
aacagattgcaagaggcttgcaaagacatcctgctgtttaagaacctggatccagagcag
atgtcccaagttttagatgccatgtttgaaaaattggtcaaagaaggggaacacgtaatt
gaccaaggtgatgacggtgacaacttttacgtcattgacagaggaacatttgatatttat
gtaaaatgtgatggcgttggaagatgcgtcggtaactatgataaccgtgggagttttgga
gaactggccttaatgtacaatacacccagagcagctacaatcactgctacctctcctggt
gctctgtggggtttggacagggtgaccttcaggagaataattgtaaaaaacaatgccaaa
aagaggaagatgtacgagagctttatcgagtccctgccgttcctcaagtctctagaggtt
tctgaacgcctgaaggtggtggatgtgattggcaccaaagtttacaatgatggagagcag
atcattgctcagggagatttggcagactctttcttcattgtagaatctggagaagtgaaa
attactatgaaaagaaagggtaaatcagaagttgaagagaacggagctgtggaaatcgct
cggtgctttcggggccagtactttggagagcttgccctggtcactaacaaaccaagagca
gcgtctgcacacgccatcgggactgtcaaatgcttagccatggatgtgcaagcatttgaa
aggcttttgggaccttgcatggaaattatgaagaggaacatcgccacctatgaagaacaa
ttagttgcgctgtttggaacaaacatggatattgttgagcccactgcatga

DBGET integrated database retrieval system