KEGG   Mus musculus (mouse): 19091Help
Entry
19091             CDS       T01002                                 

Gene name
Prkg1, AW125416, CGKI, Gm19690, Prkg1b, Prkgr1b
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Vascular smooth muscle contraction
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    19091 (Prkg1)
 Cellular Processes
  Cellular commiunity
   04540 Gap junction
    19091 (Prkg1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19091 (Prkg1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    19091 (Prkg1)
  Digestive system
   04970 Salivary secretion
    19091 (Prkg1)
  Nervous system
   04730 Long-term depression
    19091 (Prkg1)
  Sensory system
   04740 Olfactory transduction
    19091 (Prkg1)
  Environmental adaptation
   04713 Circadian entrainment
    19091 (Prkg1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     19091 (Prkg1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   19091 (Prkg1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
19; 19 C2
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactggaggaagactttgcgaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaaactc
cacaaatgccagtcggtgctgccggtgccctccacccacatcggcccgcggaccacccgg
gcgcagggcatctccgcggagccgcagacctacaggtccttccacgacctgcgccaggcg
ttccggaagttcactaaatccgagaggtcgaaggatctcataaaggaggctatccttgac
aatgacttcatgaagaacttggagctgtcacagatccaggagattgtggactgtatgtac
cccgtggaatacggcaaggacagctgcatcatcaaggaaggcgatgtggggtcactggtg
tacgtcatggaagatgggaaggttgaagtcacaaaagaaggcgtgaagctctgcaccatg
ggtcctggaaaagtgttcggggagctggctatactttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccatcgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtacatggaatttttaaaaagtgttcca
acattccagagccttcctgatgaaatcctcagcaagctggctgatgtcctcgaagagacc
cactatgaaaatggagaatatatcatcaggcagggtgcaagaggagacaccttcttcatc
atcagtaaagggcaggtgaatgttactcgagaagactcaccaagtgaagacccagtcttc
cttagaactttagggaagggagattggtttggagagaaagcgttgcagggggaggatgtg
agaacagcaaatgttattgccgcagaagctgtcacctgccttgtgattgacagagactct
ttcaagcatttgattggaggactggacgatgtttctaacaaagcatatgaggacgcagaa
gcaaaagcaaaatatgaagccgaagctgccttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggtttcggacgagtagagctggtccagttgaaa
agtgaagaatccaaaacatttgcaatgaagatcctcaagaaacgccacattgtggacacc
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattctgacttc
attgtgaggctgtacaggacatttaaagacagcaaatacttgtatatgttgatggaagcg
tgcctgggtggagagctctggactattctcagggataggggttcgtttgaagactcaaca
accaggttttacactgcatgtgtggtagaagcattcgcctatctgcattccaaaggaatc
atttacagggacctcaagccggagaatctcatcctagatcatcgaggctatgccaaactg
gttgactttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagaatatgtagccccagagatcatcctgaacaaaggccatgacatttcagctgac
tactggtcactaggaattctgatgtatgagcttctgactggcagcccacctttctcaggc
ccagatccaatgaaaacctacaatatcatactgcgggggattgacatgatagaatttcca
aagaagattgcaaaaaatgctgctaatttaattaaaaaactatgcagggacaacccatca
gagaggttaggaaatttgaaaaacggagtcaaagacattcagaaacacaagtggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcccataattccaagtgtt
gcgtcacccacagacacaagcaattttgacagtttccctgaggacagcgatgagccacca
cctgatgacaactcaggctgggacatagacttctaa

DBGET integrated database retrieval system