KEGG   Mus musculus (mouse): 19091Help
Entry
19091             CDS       T01002                                 

Gene name
Prkg1, AW125416, CGKI, Gm19690, Prkg1b, Prkgr1b
Definition
protein kinase, cGMP-dependent, type I (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mmu  Mus musculus (mouse)
Pathway
Vascular smooth muscle contraction
Gap junction
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Class
Cellular Processes; Cell communication; Gap junction [PATH:mmu04540]
Organismal Systems; Circulatory system; Vascular smooth muscle contraction [PATH:mmu04270]
Organismal Systems; Digestive system; Salivary secretion [PATH:mmu04970]
Organismal Systems; Nervous system; Long-term depression [PATH:mmu04730]
Organismal Systems; Sensory system; Olfactory transduction [PATH:mmu04740]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:mmu04713]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
19; 19 C2
AA seq 671 aa AA seqDB search
MSELEEDFAKILMLKEERIKELEKRLSEKEEEIQELKRKLHKCQSVLPVPSTHIGPRTTR
AQGISAEPQTYRSFHDLRQAFRKFTKSERSKDLIKEAILDNDFMKNLELSQIQEIVDCMY
PVEYGKDSCIIKEGDVGSLVYVMEDGKVEVTKEGVKLCTMGPGKVFGELAILYNCTRTAT
VKTLVNVKLWAIDRQCFQTIMMRTGLIKHTEYMEFLKSVPTFQSLPDEILSKLADVLEET
HYENGEYIIRQGARGDTFFIISKGQVNVTREDSPSEDPVFLRTLGKGDWFGEKALQGEDV
RTANVIAAEAVTCLVIDRDSFKHLIGGLDDVSNKAYEDAEAKAKYEAEAAFFANLKLSDF
NIIDTLGVGGFGRVELVQLKSEESKTFAMKILKKRHIVDTRQQEHIRSEKQIMQGAHSDF
IVRLYRTFKDSKYLYMLMEACLGGELWTILRDRGSFEDSTTRFYTACVVEAFAYLHSKGI
IYRDLKPENLILDHRGYAKLVDFGFAKKIGFGKKTWTFCGTPEYVAPEIILNKGHDISAD
YWSLGILMYELLTGSPPFSGPDPMKTYNIILRGIDMIEFPKKIAKNAANLIKKLCRDNPS
ERLGNLKNGVKDIQKHKWFEGFNWEGLRKGTLTPPIIPSVASPTDTSNFDSFPEDSDEPP
PDDNSGWDIDF
NT seq 2016 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaactggaggaagactttgcgaagattctcatgctcaaggaggagaggatcaaa
gagctggagaagcggctgtcagagaaggaggaagaaatccaggagctgaagaggaaactc
cacaaatgccagtcggtgctgccggtgccctccacccacatcggcccgcggaccacccgg
gcgcagggcatctccgcggagccgcagacctacaggtccttccacgacctgcgccaggcg
ttccggaagttcactaaatccgagaggtcgaaggatctcataaaggaggctatccttgac
aatgacttcatgaagaacttggagctgtcacagatccaggagattgtggactgtatgtac
cccgtggaatacggcaaggacagctgcatcatcaaggaaggcgatgtggggtcactggtg
tacgtcatggaagatgggaaggttgaagtcacaaaagaaggcgtgaagctctgcaccatg
ggtcctggaaaagtgttcggggagctggctatactttacaactgtacccggacagcgacc
gtcaagactcttgtaaatgtgaaactctgggccatcgatcgacaatgttttcaaacaata
atgatgaggacaggactcatcaagcataccgagtacatggaatttttaaaaagtgttcca
acattccagagccttcctgatgaaatcctcagcaagctggctgatgtcctcgaagagacc
cactatgaaaatggagaatatatcatcaggcagggtgcaagaggagacaccttcttcatc
atcagtaaagggcaggtgaatgttactcgagaagactcaccaagtgaagacccagtcttc
cttagaactttagggaagggagattggtttggagagaaagcgttgcagggggaggatgtg
agaacagcaaatgttattgccgcagaagctgtcacctgccttgtgattgacagagactct
ttcaagcatttgattggaggactggacgatgtttctaacaaagcatatgaggacgcagaa
gcaaaagcaaaatatgaagccgaagctgccttcttcgccaacctgaagctgtctgatttc
aacatcattgacacccttggagttggaggtttcggacgagtagagctggtccagttgaaa
agtgaagaatccaaaacatttgcaatgaagatcctcaagaaacgccacattgtggacacc
agacagcaggagcacatccgctcagagaagcagatcatgcagggggctcattctgacttc
attgtgaggctgtacaggacatttaaagacagcaaatacttgtatatgttgatggaagcg
tgcctgggtggagagctctggactattctcagggataggggttcgtttgaagactcaaca
accaggttttacactgcatgtgtggtagaagcattcgcctatctgcattccaaaggaatc
atttacagggacctcaagccggagaatctcatcctagatcatcgaggctatgccaaactg
gttgactttggctttgcaaagaaaataggatttggaaagaaaacatggactttttgtggg
actccagaatatgtagccccagagatcatcctgaacaaaggccatgacatttcagctgac
tactggtcactaggaattctgatgtatgagcttctgactggcagcccacctttctcaggc
ccagatccaatgaaaacctacaatatcatactgcgggggattgacatgatagaatttcca
aagaagattgcaaaaaatgctgctaatttaattaaaaaactatgcagggacaacccatca
gagaggttaggaaatttgaaaaacggagtcaaagacattcagaaacacaagtggtttgag
ggctttaattgggaaggcttaagaaaaggcaccttgacacctcccataattccaagtgtt
gcgtcacccacagacacaagcaattttgacagtttccctgaggacagcgatgagccacca
cctgatgacaactcaggctgggacatagacttctaa

DBGET integrated database retrieval system