KEGG   Mus musculus (mouse): 19092Help
Entry
19092             CDS       T01002                                 

Gene name
Prkg2, AW212535, CGKII, Prkgr2, cGK-II
Definition
protein kinase, cGMP-dependent, type II (EC:2.7.11.12)
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Gap junction
Platelet activation
Circadian entrainment
Long-term depression
Olfactory transduction
Salivary secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    19092 (Prkg2)
 Cellular Processes
  Cell communication
   04540 Gap junction
    19092 (Prkg2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19092 (Prkg2)
  Digestive system
   04970 Salivary secretion
    19092 (Prkg2)
  Nervous system
   04730 Long-term depression
    19092 (Prkg2)
  Sensory system
   04740 Olfactory transduction
    19092 (Prkg2)
  Environmental adaptation
   04713 Circadian entrainment
    19092 (Prkg2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     19092 (Prkg2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   19092 (Prkg2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 E3; 5 48.35 cM
AA seq 762 aa AA seqDB search
MGNGSVKPKHAKHPDGHSGNLSNEALRSKVLELERELRRKDAELQEREYHLKELREQLAK
QTVAIAELTEELQSKCIQLNKLQDVIHVQGGSPLQASPDKVPLDVHRKTSGLVSLHSRRG
AKAGVSAEPTTRTYDLNKPPEFSFEKARVRKDSSEKKLITDALNKNQFLKRLDPQQIKDM
VECMYGRNYQQGSYVIKQGEPGNHIFVLAEGRLEVFQGEKLLSSIPMWTTFGELAILYNC
TRTASVKAITNVKTWALDREVFQNIMRRTAQARDEEYRNFLRSVSLLKNLPEDKLTKIID
CLEVEYYDKGDYIIREGEEGSTFFILAKGKVKVTQSTEGHDQPQLIKTLQKGEYFGEKAL
ISDDVRSANIIAEENDVACLVIDRETFNQTVGTFDELQKYLEGYVATLNRDDEKRHAKRS
MSSWKLSKALSLEMIQLKEKVARFSSTSPFQNLEIIATLGVGGFGRVELVKVKNENVAFA
MKCIRKKHIVDTKQQEHVYSEKRILEELCSPFIVKLYRTFKDNKYVYMLLEACLGGELWS
ILRDRGSFDEPTSKFCVACVTEAFDYLHRLGIIYRDLKPENLILDADGYLKLVDFGFAKK
IGSGQKTWTFCGTPEYVAPEVILNKGHDFSVDFWSLGILVYELLTGNPPFSGIDQMMTYN
LILKGIEKMDFPRKITRRPEDLIRRLCRQNPTERLGNLKNGINDIKKHRWLNGFNWEGLK
ARSLPSPLRRELSGPIDHSYFDKYPPEKGVPPDEMSGWDKDF
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atgggaaatggttcagtgaagcccaagcatgctaagcacccagatggccattcagggaac
ctcagcaatgaagccctgcggagcaaggtgttggagctggagcgggagctgaggaggaag
gacgcggaacttcaggaacgggagtaccacctgaaggagcttcgggagcagctggccaag
cagaccgtggccatcgcagagctcacagaagaactgcagagcaagtgcatccagctgaac
aagctgcaggatgtgatccacgtgcagggaggaagcccactgcaggcctctcccgacaaa
gtgcctctggatgttcaccgcaagacctcaggcttggtctcgctccacagcaggaggggg
gcgaaggctggagtgtctgcagagccaaccacccgaacctatgacctcaacaaacccccc
gagttttcctttgagaaagcgagagtcaggaaggattccagtgagaaaaagctcatcaca
gatgccctgaataagaaccagtttctgaagagattggatccccagcagatcaaggacatg
gtggaatgcatgtacgggagaaactatcaacagggcagctacgtcattaagcagggggaa
ccaggcaaccatatctttgtgctggccgagggtagacttgaggtgttccagggagagaag
ttgctatcatccatcccaatgtggaccacgtttggggaactggctattttgtacaactgt
actcggactgcctcagtgaaagcgattaccaatgttaaaacttgggccctcgatagagag
gttttccagaacattatgaggagaacagcccaagcccgggatgaggagtacagaaacttc
ctcagaagtgtctccttgttgaagaatttacctgaagacaaactaaccaagatcattgac
tgcttggaagtggaatactatgacaaaggagattacatcatcagagaaggagaagaaggg
agcacctttttcattttggcaaaaggcaaggtgaaagtcacacagagcacagagggccat
gatcagccacagttgatcaagacactgcagaaaggagagtactttggagaaaaggctctg
atcagtgatgacgtcagatcagccaatataattgcggaagaaaatgatgtcgcatgcctc
gtgatagatcgagaaacattcaaccaaactgtcgggacatttgatgaactccaaaaatat
cttgaggggtatgtggccaccctgaaccgtgacgatgaaaaaagacacgcaaagcgctcc
atgtctagctggaagctgtccaaagccctttctctggagatgattcagctgaaagagaag
gtggcccgattctcctcaacctccccattccagaacctcgagattatcgcaacactgggc
gttggtgggttcggaagagtggagcttgttaaagtgaaaaatgagaatgttgcttttgcc
atgaagtgtataaggaagaagcacattgttgatacaaagcagcaagaacatgtctactca
gaaaagaggatcctggaagagctgtgttctcccttcatcgtgaagttgtatcgtactttc
aaggacaataaatatgtatacatgcttctggaggcctgcttaggtggggagctgtggagt
atactgagggacagaggcagcttcgatgaacccacctccaaattctgtgtcgcttgtgtg
acagaagcatttgattatctgcaccgactaggcatcatctacagagacctgaagccagag
aacttaattctggatgccgatggctaccttaagttggttgactttggattcgctaagaag
attggctctggacagaaaacgtggacattctgtgggactccagagtatgtggcccccgag
gtcattcttaacaaaggacatgacttcagtgtggatttctggtccctggggattctggtc
tatgagctcctaacgggcaaccctcccttttctgggatagaccaaatgatgacctacaat
ttgattctcaagggaatcgagaaaatggatttccccagaaagataacaaggcgccctgag
gatttgatccggaggctttgcaggcaaaacccaacagaaaggctgggaaatctgaagaac
gggatcaacgacattaagaaacacaggtggttaaatggttttaattgggaagggctgaaa
gcacggagccttccgtcacctttacggagagagctcagtggccccatagatcacagctac
tttgacaagtatcctcctgaaaagggggtgcctccggatgaaatgtcaggctgggataaa
gacttctga

DBGET integrated database retrieval system