KEGG   Mus musculus (mouse): 19094Help
Entry
19094             CDS       T01002                                 

Gene name
Mapk11, P38b, Prkm11, Sapk2, Sapk2b, p38-2, p38beta, p38beta2
Definition
(RefSeq) mitogen-activated protein kinase 11
  KO
K04441  p38 MAP kinase [EC:2.7.11.24]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu01522  Endocrine resistance
mmu04010  MAPK signaling pathway
mmu04015  Rap1 signaling pathway
mmu04068  FoxO signaling pathway
mmu04071  Sphingolipid signaling pathway
mmu04218  Cellular senescence
mmu04261  Adrenergic signaling in cardiomyocytes
mmu04370  VEGF signaling pathway
mmu04380  Osteoclast differentiation
mmu04550  Signaling pathways regulating pluripotency of stem cells
mmu04611  Platelet activation
mmu04620  Toll-like receptor signaling pathway
mmu04621  NOD-like receptor signaling pathway
mmu04622  RIG-I-like receptor signaling pathway
mmu04625  C-type lectin receptor signaling pathway
mmu04657  IL-17 signaling pathway
mmu04658  Th1 and Th2 cell differentiation
mmu04659  Th17 cell differentiation
mmu04660  T cell receptor signaling pathway
mmu04664  Fc epsilon RI signaling pathway
mmu04668  TNF signaling pathway
mmu04670  Leukocyte transendothelial migration
mmu04714  Thermogenesis
mmu04722  Neurotrophin signaling pathway
mmu04723  Retrograde endocannabinoid signaling
mmu04728  Dopaminergic synapse
mmu04750  Inflammatory mediator regulation of TRP channels
mmu04912  GnRH signaling pathway
mmu04914  Progesterone-mediated oocyte maturation
mmu04917  Prolactin signaling pathway
mmu04926  Relaxin signaling pathway
mmu04933  AGE-RAGE signaling pathway in diabetic complications
mmu05014  Amyotrophic lateral sclerosis (ALS)
mmu05132  Salmonella infection
mmu05133  Pertussis
mmu05140  Leishmaniasis
mmu05142  Chagas disease (American trypanosomiasis)
mmu05145  Toxoplasmosis
mmu05152  Tuberculosis
mmu05160  Hepatitis C
mmu05164  Influenza A
mmu05167  Kaposi's sarcoma-associated herpesvirus infection
mmu05169  Epstein-Barr virus infection
mmu05205  Proteoglycans in cancer
mmu05418  Fluid shear stress and atherosclerosis
Module
mmu_M00689  MAPK (p38) signaling
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04015 Rap1 signaling pathway
    19094 (Mapk11)
   04010 MAPK signaling pathway
    19094 (Mapk11)
   04370 VEGF signaling pathway
    19094 (Mapk11)
   04668 TNF signaling pathway
    19094 (Mapk11)
   04068 FoxO signaling pathway
    19094 (Mapk11)
   04071 Sphingolipid signaling pathway
    19094 (Mapk11)
 Cellular Processes
  Cell growth and death
   04218 Cellular senescence
    19094 (Mapk11)
  Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    19094 (Mapk11)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19094 (Mapk11)
   04620 Toll-like receptor signaling pathway
    19094 (Mapk11)
   04621 NOD-like receptor signaling pathway
    19094 (Mapk11)
   04622 RIG-I-like receptor signaling pathway
    19094 (Mapk11)
   04625 C-type lectin receptor signaling pathway
    19094 (Mapk11)
   04660 T cell receptor signaling pathway
    19094 (Mapk11)
   04658 Th1 and Th2 cell differentiation
    19094 (Mapk11)
   04659 Th17 cell differentiation
    19094 (Mapk11)
   04657 IL-17 signaling pathway
    19094 (Mapk11)
   04664 Fc epsilon RI signaling pathway
    19094 (Mapk11)
   04670 Leukocyte transendothelial migration
    19094 (Mapk11)
  Endocrine system
   04912 GnRH signaling pathway
    19094 (Mapk11)
   04914 Progesterone-mediated oocyte maturation
    19094 (Mapk11)
   04917 Prolactin signaling pathway
    19094 (Mapk11)
   04926 Relaxin signaling pathway
    19094 (Mapk11)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    19094 (Mapk11)
  Nervous system
   04728 Dopaminergic synapse
    19094 (Mapk11)
   04723 Retrograde endocannabinoid signaling
    19094 (Mapk11)
   04722 Neurotrophin signaling pathway
    19094 (Mapk11)
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    19094 (Mapk11)
  Development
   04380 Osteoclast differentiation
    19094 (Mapk11)
  Environmental adaptation
   04714 Thermogenesis
    19094 (Mapk11)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    19094 (Mapk11)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    19094 (Mapk11)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    19094 (Mapk11)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    19094 (Mapk11)
  Infectious diseases
   05132 Salmonella infection
    19094 (Mapk11)
   05133 Pertussis
    19094 (Mapk11)
   05152 Tuberculosis
    19094 (Mapk11)
   05164 Influenza A
    19094 (Mapk11)
   05160 Hepatitis C
    19094 (Mapk11)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    19094 (Mapk11)
   05169 Epstein-Barr virus infection
    19094 (Mapk11)
   05145 Toxoplasmosis
    19094 (Mapk11)
   05140 Leishmaniasis
    19094 (Mapk11)
   05142 Chagas disease (American trypanosomiasis)
    19094 (Mapk11)
  Drug resistance
   01522 Endocrine resistance
    19094 (Mapk11)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     19094 (Mapk11)
Protein kinases [BR:mmu01001]
 Serine/threonine kinases: CMGC group
  MAPK family [OT]
   19094 (Mapk11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo APH RIO1 Cas_CT1975 Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 19094
NCBI-ProteinID: NP_035291
MGI: 1338024
Ensembl: ENSMUSG00000053137
UniProt: Q9WUI1
Position
15; 15 E3
AA seq 364 aa AA seqDB search
MSGPRAGFYRQELNKTVWEVPQRLQGLRPVGSGAYGSVCSAYDARLRQKVAVKKLSRPFQ
SLIHARRTYRELRLLKHLKHENVIGLLDVFTPATSIEDFSEVYLVTTLMGADLNNIVKCQ
ALSDEHVQFLVYQLLRGLKYIHSAGIIHRDLKPSNVAVNEDCELRILDFGLARQADEEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLQGKALFPGNDYIDQLKRIMEVVG
TPSPEVLAKISSEHARTYIQSLPPMPQKDLSSVFHGANPLAIDLLGRMLVLDSDQRVSAA
EALAHAYFSQYHDPDDEPEAEPYDESVEAKERTLEEWKELTYQEVLSFKPLEPSQLPGTH
EIEQ
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggtccgcgcgcgggattctaccggcaagagctgaacaaaacagtatgggaggtg
ccgcagcggctgcagggcctacgcccggtgggctccggcgcctacggctcagtctgctcg
gcctacgacgcgcggctgcgccagaaggtggctgtaaagaagctgtctcgccctttccaa
tcgctgatccacgcgaggaggacataccgtgagctgcgcctactcaagcacctgaagcac
gagaacgtcataggacttttggacgtcttcacgccggccacatccatcgaggatttcagc
gaagtgtacctcgtgacgaccctgatgggcgccgacctgaataacatcgtcaagtgtcag
gccctgagcgatgagcatgttcaattccttgtctaccagctgctgcgtgggctgaagtat
atccactcggcgggcatcatccaccgggacctgaagcccagcaatgtagcggtgaacgag
gactgcgagctgaggatcctggactttgggctagcacgccaggctgatgaggagatgacc
ggatatgtggccacacggtggtaccgggcgccagagatcatgctaaactggatgcactac
aaccagacagtggacatctggtctgtgggctgcatcatggctgaactgctgcaaggaaag
gccctctttcctggaaacgactacatcgaccagctgaagcgaatcatggaggtggtgggc
acgcccagtcctgaggttctggcaaagatatcctcggagcatgcccggacatacatccag
tctctgcctcccatgccccagaaggacctcagcagtgtcttccatggagccaaccccctg
gccatagacctccttggaagaatgctggtactagacagcgaccagagggtcagtgcggcc
gaagccttggcccacgcatacttcagccagtaccatgaccctgacgatgagccagaggca
gagccctatgatgaaagtgttgaggccaaggagcgcacgctggaggagtggaaggagctt
acttaccaagaagtccttagcttcaagcccctggaaccctcacagctccctggcacccat
gaaattgagcagtga

DBGET integrated database retrieval system