KEGG   Mus musculus (mouse): 19106Help
Entry
19106             CDS       T01002                                 

Gene name
Eif2ak2, 2310047A08Rik, 4732414G15Rik, AI467567, AI747578, Pkr, Prkr, Tik
Definition
(RefSeq) eukaryotic translation initiation factor 2-alpha kinase 2 (EC:2.7.11.1 2.7.10.2)
  KO
K16195  
eukaryotic translation initiation factor 2-alpha kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Protein processing in endoplasmic reticulum
Hepatitis C
Measles
Influenza A
Herpes simplex infection
Epstein-Barr virus infection
Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    19106 (Eif2ak2)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    19106 (Eif2ak2)
  Infectious diseases
   05162 Measles
    19106 (Eif2ak2)
   05164 Influenza A
    19106 (Eif2ak2)
   05160 Hepatitis C
    19106 (Eif2ak2)
   05168 Herpes simplex infection
    19106 (Eif2ak2)
   05169 Epstein-Barr virus infection
    19106 (Eif2ak2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19106 (Eif2ak2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: Other group
  PEK family [OT]
   19106 (Eif2ak2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     19106 (Eif2ak2)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    P-body specific factors
     19106 (Eif2ak2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
17 49.56 cM; 17 E2
AA seq 515 aa AA seqDB search
MASDTPGFYMDKLNKYRQMHGVAITYKELSTSGPPHDRRFTFQVLIDEKEFPEAKGRSKQ
EARNAAAKLAVDILDNENKVDCHTSASEQGLFVGNYIGLVNSFAQKKKLSVNYEQCEPNS
ELPQRFICKCKIGQTMYGTGSGVTKQEAKQLAAKEAYQKLLKSPPKTAGTSSSVVTSTFS
GFSSSSSMTSNGVSQSAPGSFSSENVFTNGLGENKRKSGVKVSPDDVQRNKYTLDARFNS
DFEDIEEIGLGGFGQVFKAKHRIDGKRYAIKRVKYNTEKAEHEVQALAELNHVNIVQYHS
CWEGVDYDPEHSMSDTSRYKTRCLFIQMEFCDKGTLEQWMRNRNQSKVDKALILDLYEQI
VTGVEYIHSKGLIHRDLKPGNIFLVDERHIKIGDFGLATALENDGKSRTRRTGTLQYMSP
EQLFLKHYGKEVDIFALGLILAELLHTCFTESEKIKFFESLRKGDFSNDIFDNKEKSLLK
KLLSEKPKDRPETSEILKTLAEWRNISEKKKRNTC
NT seq 1548 nt NT seq  +upstreamnt  +downstreamnt
atggccagtgataccccaggtttctacatggacaaacttaataaataccgccagatgcac
ggagtagccattacgtataaagaacttagtacttcgggacctccacatgacagaaggttt
acatttcaagttttaatagatgagaaggaatttccagaagccaaaggtagatcaaagcag
gaggcaagaaacgctgcagccaaattagctgttgatatacttgataacgaaaacaaggtg
gattgtcacacgagtgcatctgagcaaggcttgttcgttggtaactacataggccttgtc
aatagctttgcccagaagaaaaagctgtctgtaaattatgaacagtgtgagcccaactct
gagttgcctcaaagatttatttgtaaatgcaaaattgggcagacaatgtatggtactggt
tcaggtgtcaccaaacaggaggcaaagcagttggctgcgaaagaagcctatcagaagctg
ttaaagagcccgccgaaaactgccggaacatcctctagcgttgtcacatctacattcagt
ggcttttccagcagctcgtctatgacaagtaatggtgtttcccagtcagcacctggaagt
ttttcctcagagaacgtgtttacgaacggtctcggagaaaataaaaggaaatcaggagta
aaagtatcccctgatgatgtgcaaagaaataaatataccttggacgccaggtttaacagc
gattttgaagacatagaagaaattggcttaggtggatttggtcaagttttcaaagcgaaa
cacagaattgatggaaagagatacgctattaagcgcgttaaatataacacggagaaggcg
gagcacgaagtacaagcgctggcagaactcaatcacgtcaacattgtccaataccatagt
tgttgggagggagttgactatgatcctgagcacagcatgagtgatacaagtcgatacaaa
acccggtgcctctttattcaaatggaattctgtgataaaggaactttggagcaatggatg
agaaacagaaatcagagtaaagtggacaaagctttgattttggacttatatgaacaaatc
gtgaccggagtggagtatatacactcgaaagggttaattcacagagatcttaagccaggt
aatatatttttagtagatgaaagacacattaagatcggagactttggccttgcaacagcc
ctggaaaatgatggaaaatcccgaacaaggagaacaggaactcttcaatacatgagtcca
gaacagttatttttaaagcactatggaaaagaagtggacatctttgctttgggccttatt
ctagctgaacttcttcacacgtgcttcacggagtcagagaaaataaagtttttcgaaagt
ctaagaaaaggcgacttctctaatgatatattcgacaacaaagaaaaaagccttctaaaa
aaactactctcagagaaacccaaggaccgacctgagacatctgaaatcctgaagaccttg
gctgaatggaggaacatctcagagaaaaagaaaagaaacacatgttag

DBGET integrated database retrieval system