KEGG   Mus musculus (mouse): 19116Help
Entry
19116             CDS       T01002                                 

Gene name
Prlr, AI987712, Pr-1, Pr-3, Prlr-rs1
Definition
prolactin receptor
Orthology
K05081  
prolactin receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Cytokine-cytokine receptor interaction
Neuroactive ligand-receptor interaction
PI3K-Akt signaling pathway
Jak-STAT signaling pathway
Prolactin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    19116 (Prlr)
   04151 PI3K-Akt signaling pathway
    19116 (Prlr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19116 (Prlr)
   04060 Cytokine-cytokine receptor interaction
    19116 (Prlr)
 Organismal Systems
  Endocrine system
   04917 Prolactin signaling pathway
    19116 (Prlr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
15 A1; 15 5.23 cM
AA seq 310 aa AA seqDB search
MSSALAYMLLVLSISLLNGQSPPGKPEIHKCRSPDKETFTCWWNPGSDGGLPTNYSLTYS
KEGEKNTYECPDYKTSGPNSCFFSKQYTSIWKIYIITVNATNEMGSSTSDPLYVDVTYIV
EPEPPRNLTLEVKQLKDKKTYLWVKWLPPTITDVKTGWFTMEYEIRLKSEEADEWEIHFT
GHQTQFKVFDLYPGQKYLVQTRCKPDHGYWSRWGQEKSIEIPNDFTLKDTTVWIIVAVLS
AVICLIMVWAVALKGYSMMTCIFPPVPGPKIKGFDTHLLETGSPSKYKVDPRLALPGRFQ
KLDNEGELDY
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctgcacttgcttacatgctgcttgtcctcagcatcagcctcctgaatggacag
tcaccacctggaaaacctgaaatccacaaatgtcgttcccctgacaaggaaacattcacc
tgctggtggaatcctgggtcagatggaggactccccaccaattattcattgacatacagc
aaagaaggagagaaaaacacctatgaatgtccagactacaaaaccagtggccccaattcc
tgtttctttagcaagcagtacacttccatatggaaaatatacatcatcacagtaaatgcc
acgaacgaaatgggaagcagtacctcggatccactttatgtggatgtgacttacattgtt
gaaccagagcctcctcggaacctgactttagaagtgaaacaactaaaagacaaaaaaaca
tatctgtgggtaaaatggttgccacctaccataactgatgtaaaaactggttggtttaca
atggaatatgaaattcgattaaagtctgaagaagcagatgagtgggagatccacttcaca
ggtcatcaaacacaatttaaggtttttgacttatatccaggacaaaagtatcttgtccag
actcgctgcaagccagaccatggatactggagtagatggggccaggagaaatctattgaa
ataccaaatgacttcaccttgaaagacacaactgtgtggatcattgtggccgttctctct
gctgtcatctgtttgattatggtctgggcagtggctttgaagggttatagcatgatgacc
tgcatctttccaccagttccggggccaaaaataaaaggatttgatactcatctgctagag
actggctctccaagcaaatacaaggtggatccacgcctggcccttcctggacgattccaa
aaactggacaatgaaggggaacttgactactga

DBGET integrated database retrieval system