KEGG   Mus musculus (mouse): 19123Help
Entry
19123             CDS       T01002                                 

Gene name
Proc, PC
Definition
(RefSeq) protein C
  KO
K01344  
protein C (activated) [EC:3.4.21.69]
Organism
mmu  Mus musculus (mouse)
Pathway
Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04610 Complement and coagulation cascades
    19123 (Proc)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.69  protein C (activated)
     19123 (Proc)
Peptidases [BR:mmu01002]
 Serine Peptidases
  Family S1: chymotrypsin family
   19123 (Proc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 B3
AA seq 460 aa AA seqDB search
MWQFRVFLLLMSTWGISSIPAHPDPVFSSSEHAHQVLRVRRANSFLEEMRPGSLERECME
EICDFEEAQEIFQNVEDTLAFWIKYFDGDQCSAPPLDHQCDSPCCGHGTCIDGIGSFSCS
CDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEESNGRRCACAPGYELADDHMRCKSTVNF
PCGKLGRWIEKKRKILKRDTDLEDELEPDPRIVNGTLTKQGDSPWQAILLDSKKKLACGG
VLIHTSWVLTAAHCVEGTKKLTVRLGEYDLRRRDHWELDLDIKEILVHPNYTRSSSDNDI
ALLRLAQPATLSKTIVPICLPNNGLAQELTQAGQETVVTGWGYQSDRIKDGRRNRTFILT
FIRIPLVARNECVEVMKNVVSENMLCAGIIGDTRDACDGDSGGPMVVFFRGTWFLVGLVS
WGEGCGHTNNYGIYTKVGSYLKWIHSYIGEKGVSLKSQKL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaattcagagtcttcctgctgctcatgtccacctggggaatatctagcataccg
gcccatcctgacccagtgttctccagcagcgagcatgcccaccaggtgcttcgggtcaga
cgtgccaacagcttcctggaagagatgcggccaggcagcctggaacgggagtgtatggag
gagatctgtgacttcgaggaggcccaggagattttccaaaatgtggaagacacactggcc
ttctggatcaagtactttgacggtgaccagtgctcggctccacccttggaccaccagtgc
gacagcccatgctgcgggcatggcacttgcatcgacggcataggcagcttcagctgcagc
tgcgataagggctgggagggcaagttctgtcagcaggagttgcgcttccaggactgtcgg
gtgaacaatggcggctgcttgcactactgcctggaggagagcaatgggcggcgctgcgct
tgtgccccgggctatgagctggcagacgaccacatgcgctgcaagtccactgtgaatttt
ccatgtgggaaactggggaggtggatagagaagaaacgcaagatcctcaaacgagacaca
gacttagaagatgaactggaaccagatccaaggatagtcaacggaacgctgacgaagcag
ggtgacagtccttggcaggcaatccttctggactccaagaagaagctggcctgcggaggg
gtgctcatccacacttcctgggtgctgacggcagcccactgcgtggagggcaccaagaag
cttaccgtgaggcttggtgagtatgatctgcgacgcagggaccactgggagctggacctg
gacatcaaggagatcctcgtccaccctaactacacccggagcagcagtgacaacgacatt
gctctgctccgcctagcccagccagccactctctccaaaaccatagtgcccatctgcctg
ccgaacaatgggctggcgcaggagctcactcaggctggccaggagacagtggtgacaggc
tggggctatcaaagcgacagaatcaaggatggcagaaggaaccgcaccttcatcctcacc
ttcatccgcatccctttggttgctcgaaatgagtgcgtggaggtcatgaagaatgtggtc
tcggagaacatgctgtgtgcaggcatcattggggacacgagagacgcctgtgatggtgac
agtggggggcccatggtggtcttctttcggggtacctggttcctggtgggcctggtgagc
tggggtgagggctgtgggcacaccaacaactatggcatctacaccaaagtgggaagctac
ctcaaatggattcacagttacattggggaaaagggtgtctcccttaagagccagaagcta
tag

DBGET integrated database retrieval system