KEGG   Mus musculus (mouse): 19173Help
Entry
19173             CDS       T01002                                 

Gene name
Psmb5
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 5 (EC:3.4.25.1)
  KO
K02737  
20S proteasome subunit beta 5 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Proteasome
Module
Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    19173 (Psmb5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19173 (Psmb5)
Peptidases [BR:mmu01002]
 Threonine Peptidases
  Family T1: proteasome family
   19173 (Psmb5)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19173 (Psmb5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 27.86 cM; 14 C2-D1
AA seq 264 aa AA seqDB search
MALASVLQRPMPVNQHGFFGLGGGADLLDLGPGSPGDGLSLAAPSWGVPEEPRIEMLHGT
TTLAFKFLHGVIVAADSRATAGAYIASQTVKKVIEINPYLLGTMAGGAADCSFWERLLAR
QCRIYELRNKERISVAAASKLLANMVYQYKGMGLSMGTMICGWDKRGPGLYYVDSEGNRI
SGTAFSVGSGSVYAYGVMDRGYSYDLKVEEAYDLARRAIYQATYRDAYSGGAVNLYHVRE
DGWIRVSSDNVADLHDKYSSVSVP
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggctagcgtgttgcagcggccgatgccggtgaatcagcacgggttttttggg
ctcggaggtggtgcagatctgctggacttgggtccggggagtcctggtgatgggctgagc
ctagccgcgccgagctggggcgtcccggaggagccgcgaatcgaaatgcttcacggaacc
accaccctggccttcaagtttctccatggagtcattgttgcagcggattcccgggccaca
gcaggtgcttatattgcttcccagacggtgaagaaagtaatagagatcaacccgtacctt
ctgggcaccatggctgggggtgcagcggattgcagcttctgggagcggttgttggctcgg
cagtgtcgaatctatgagcttcgcaataaggaacgcatctcggtcgcagcagcctccaaa
ctgctcgctaacatggtgtatcagtacaaaggcatggggctgtctatgggcaccatgatc
tgtggctgggataagagaggccctggcctctactacgtagacagcgaggggaacaggatc
tctgggaccgccttctcagtgggctctggctccgtgtatgcttacggcgttatggatcga
ggctactcctatgacctgaaagtggaggaggcctatgatctggcccgccgagccatctac
caagccacctacagagatgcctactccggaggggcagtcaacctctaccacgtgcgggag
gatggctggatccgggtgtccagtgacaatgtagctgacttacatgacaagtacagtagt
gtatctgtcccctga

DBGET integrated database retrieval system