KEGG   Mus musculus (mouse): 19177Help
Entry
19177             CDS       T01002                                 

Gene name
Psmb7, AU020723, MC14
Definition
(RefSeq) proteasome (prosome, macropain) subunit, beta type 7
  KO
K02739  20S proteasome subunit beta 2 [EC:3.4.25.1]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03050  Proteasome
Module
mmu_M00340  Proteasome, 20S core particle
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Folding, sorting and degradation
   03050 Proteasome
    19177 (Psmb7)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     19177 (Psmb7)
Peptidases [BR:mmu01002]
 Threonine Peptidases
  Family T1: proteasome family
   19177 (Psmb7)
Proteasome [BR:mmu03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    19177 (Psmb7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Proteasome Pr_beta_C
Motif
Other DBs
NCBI-GeneID: 19177
NCBI-ProteinID: NP_035317
MGI: 107637
Ensembl: ENSMUSG00000026750
Vega: OTTMUSG00000012864
UniProt: P70195
Structure
PDB: 

Jmol
Position
2 B; 2 24.42 cM
AA seq 277 aa AA seqDB search
MAAVSVFQPPVGGFSFDNCRRNAVLEADFAKKGFKLPKARKTGTTIAGVVYKDGIVLGAD
TRATEGMVVADKNCSKIHFISPNIYCCGAGTAADTDMTTQLISSNLELHSLTTGRLPRVV
TANRMLKQMLFRYQGYIGAALVLGGVDVTGPHLYSIYPHGSTDKLPYVTMGSGSLAAMAV
FEDKFRPDMEEEEAKKLVSEAIAAGIFNDLGSGSNIDLCVISKSKLDFLRPFSVPNKKGT
RLGRYRCEKGTTAVLTEKVTPLEIEVLEETVQTMDTS
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgtgtcggtgtttcagccaccggtcggaggcttttcttttgataattgtcgc
aggaatgctgtcttggaagcggatttcgcaaaaaaggggttcaagctcccgaaagctcgg
aaaactggcactaccatcgcgggggtggtgtataaggatggcatagttcttggagcagac
acgagagcaactgaagggatggttgttgctgacaaaaactgttcaaaaattcacttcata
tctcctaatatttattgctgtggtgctgggacagctgcagacacagacatgacaacccag
cttatttcttccaacttggagctccactctctgaccactggccgcctcccgagagttgtt
acagctaatcggatgctgaagcagatgctcttcaggtatcaaggttacattggtgcagcc
ctagttttggggggagtagatgttactggacctcatctctacagcatctatcctcatgga
tcaactgataaattgccttatgtcaccatgggttctggctccttggcagcaatggctgtg
tttgaagataagtttaggccagatatggaggaggaagaagccaagaagctagtgagtgag
gctattgcagctggcatctttaatgacttggggtctggaagcaacattgatctgtgtgtt
atcagcaagagcaagctggactttcttcgtccattctcagtgcccaacaagaaagggacc
aggcttggccggtacagatgtgagaaaggcactaccgctgtcctcaccgagaaagttacc
cctctggagattgaggtgctagaagagactgttcagacaatggatacttcgtga

DBGET integrated database retrieval system