KEGG   Mus musculus (mouse): 19204Help
Entry
19204             CDS       T01002                                 

Gene name
Ptafr, PAFR
Definition
(RefSeq) platelet-activating factor receptor
  KO
K04279  platelet-activating factor receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
mmu05150  Staphylococcus aureus infection
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    19204 (Ptafr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19204 (Ptafr)
 Human Diseases
  Infectious diseases
   05150 Staphylococcus aureus infection
    19204 (Ptafr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Other
   Platelet activating factor
    19204 (Ptafr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1
Motif
Other DBs
NCBI-GeneID: 19204
NCBI-ProteinID: NP_001074680
MGI: 106066
Ensembl: ENSMUSG00000056529
Vega: OTTMUSG00000009789
UniProt: Q62035
Position
4 D2.3; 4 65.56 cM
AA seq 341 aa AA seqDB search
MEHNGSFRVDSEFRYTLFPIVYSVIFILGVVANGYVLWVFANLYPSKKLNEIKIFMVNLT
MADLLFLITLPLWIVYYYNEGDWILPNFLCNVAGCLFFINTYCSVAFLGVITYNRYQAVA
YPIKTAQATTRKRGISLSLIIWVSIVATASYFLATDSTNLVPNKDGSGNITRCFEHYEPY
SVPILVVHVFIAFCFFLVFFLIFYCNLVIIHTLLTQPMRQQRKAGVKRRALWMVCTVLAV
FIICFVPHHVVQLPWTLAELGYQTNFHQAINDAHQITLCLLSTNCVLDPVIYCFLTKKFR
KHLSEKFYSMRSSRKCSRATSDTCTEVIVPANQTPIVSLKN
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atggagcacaatggctcctttcgtgtggattctgagtttcgatacacgctctttccgatt
gtttacagtgtcatctttatactgggggtggttgccaacggctatgtgctatgggtcttt
gctaacttgtacccttccaagaaactaaatgagataaagatctttatggtgaatctcact
atggctgacctgctcttcctgatcaccctcccactgtggattgtctactactacaacgag
ggcgactggattctacccaacttcctgtgcaacgtggctggctgcctcttcttcatcaat
acctactgcagtgtggcctttttgggtgtcatcacttataaccgctaccaggcagtagcc
tatcccatcaagactgcacaggccaccacccgcaagcgtggcatctctttgtccctgatc
atttgggtatccattgtggctactgcatcctatttcctggccacagactccaccaaccta
gtgcccaataaggatggctcaggcaacatcacccgctgctttgagcattatgagccatac
agtgtgcccatccttgttgttcatgtcttcatcgccttctgcttcttcctcgtcttcttc
cttatcttctactgcaacttggtcatcatccacacgctgctcacgcagcccatgaggcag
cagcgcaaagcgggggtgaagcggagggcgctgtggatggtctgcacggtcttggcggta
ttcatcatctgttttgtgccccatcacgtggtccagctgccctggaccctagcagagttg
ggctaccagaccaacttccatcaggctattaatgatgcccatcaaatcaccctctgcctc
ctcagcaccaactgtgtcttagatcccgttatctattgctttcttaccaagaagttccga
aagcacctcagtgagaagttttacagcatgcgcagtagccggaagtgctccagagccacg
agtgacacgtgcaccgaggtgatagtgccagccaaccagactcctattgtgtcgctgaaa
aattaa

DBGET integrated database retrieval system