KEGG   Mus musculus (mouse): 192120Help
Entry
192120            CDS       T01002                                 

Gene name
Bspry
Definition
(RefSeq) B-box and SPRY domain containing
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4; 4 C1
AA seq 486 aa AA seqDB search
MSADVSGTESGSESGPEPEPGPEPGPESRPESRPKPGPGPEPRPESGPEPGPRSGLRRGP
KQGSERSQLCPEHFEPLSWFCLSERRPVCATCAGFGGRCHRHRIRRAEEHAEELRNKIVD
QCERLQLQSAGISKYMAEVLQGKNQKAVVMASAARDLIIQRLSLVRSLCESEEQRLLEQV
HGEEERAHQSILTQRAHWVDAVQKLDTLRTNMVDMITHLDDLQLIQREQEIFERAEEAEG
ILDPQDSEKLSFNEKCAWSPLLTQLWAASVLGSLSGVEEVLIDERTVSPLLHLSEDRRTL
TFIAKKSKVCSDEPERFDHWPNALAATAFQTGLHAWIVNVKHSCAYKVGVASDQLPRKGS
GNDCRLGHNAFSWVFSRYDQEFCFSHNGYHEPLPLLRCPAQLGMLLDLQAGELVFYEPAS
GTVLHIHRASFPQVLFPVFAVADQLISIVRGPLATVRLDSPPHHPCSIRRTTCQDTVGQN
VVVGVW
NT seq 1461 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcggatgtctccgggacggagtccgggtccgagtccgggccggagccggagccg
ggaccggagcccggaccggagtcccgaccggagtcccggccgaagccgggaccgggaccg
gagcccagacccgagtccgggccggagccggggccgcgatccggactgaggaggggaccg
aagcaggggtccgagcggagccagttgtgccccgagcacttcgagcctctgagctggttc
tgcctctcggagcgacggccggtatgcgccacctgcgccgggtttggcggccgctgtcac
cggcaccgcatccgtcgagcggaggagcacgcggaggagctgagaaacaagattgtggac
cagtgtgagaggctgcagttacagagtgctggcatctccaagtatatggccgaggtcctg
caggggaagaaccagaaagcagtggtcatggctagtgcagcgagggacctgatcatccag
aggctgagtctggtgcggagcctgtgtgagagtgaggaacagcggttattggagcaggtg
cacggcgaagaggagcgggcccaccagagtatcctgactcagcgggcacactgggtggac
gcagtccagaaactggacaccctccgcaccaacatggtggacatgatcacccacctggat
gacctccagctgattcagagggaacaggagatttttgagagggccgaggaagcagagggc
attttggatccccaggattcggagaaattaagctttaatgagaagtgtgcttggagccca
ctactgacgcaactgtgggcagcatcggttctcgggtctctctcaggcgtggaggaggtg
ctgattgatgaaaggactgtcagccccttactgcatctgtctgaagatcgaaggaccctg
accttcattgccaagaagtctaaggtctgctcagatgaaccagagcgctttgaccactgg
cccaatgccctggctgccactgccttccagactgggctccatgcctggatagtgaacgtt
aaacacagttgtgcttataaagtgggtgtggcctcagatcagctgccccgaaagggctct
ggcaatgactgccgcctgggccacaatgccttctcctgggtcttctcccgctatgatcaa
gagttctgtttctcacacaatgggtatcatgagcctctgccactacttcggtgcccagca
cagctgggcatgctgctggacctgcaggcaggagagctggtcttctacgagcctgcctca
gggacggtgcttcatatccaccgtgcgtccttccctcaggtgctcttcccagtctttgct
gtggctgaccagctcatctccatcgttcgcggacctctggccacagtgagactagattca
cctccccatcacccttgcagcatacgaaggacaacctgccaggatactgttggccagaac
gtcgtcgtgggagtgtggtag

DBGET integrated database retrieval system