KEGG   Mus musculus (mouse): 192156Help
Entry
192156            CDS       T01002                                 

Gene name
Mvd, C78718, Mpd
Definition
(RefSeq) mevalonate (diphospho) decarboxylase
  KO
K01597  
diphosphomevalonate decarboxylase [EC:4.1.1.33]
Organism
mmu  Mus musculus (mouse)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Module
C5 isoprenoid biosynthesis, mevalonate pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    192156 (Mvd)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.33  diphosphomevalonate decarboxylase
     192156 (Mvd)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
8; 8 E1
AA seq 401 aa AA seqDB search
MASEKPQDLMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKD
FTEDRIWLNGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLSLSYKVHVASVNNFP
TAAGLASSAAGYACLAYTLAQVYGVEGDLSEVARRGSGSACRSLYGGFVEWQMGEQADGK
DSIARQIAPEWHWPQLRILILVVSADKKQTGSTVGMQTSVETSTLLKFRAESVVPERMKE
MTRCIQEQDFQGFAQLTMKDSNQFHATCLDTFPPISYLNDTSRRIIQLVHRFNTHQGQTK
VAYTFDAGPNAVIFTLEDTVAEFVAAVRHSFPPAANGDKFLKGLQVAPVLLSDELKAALA
VEPSPGGVQYIIATQVGPGPQVLDDTHDHLLGQDGLPQRDL
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagaaaagcctcaggacctaatggtcacctgcacggcgccggtcaacatcgca
gttatcaagtactgggggaagcgagatgaagcgctgatcctgcccatcaactcctccctg
agcgtcacgctgcaccaggaccagctaaaaacgaccacaaccgttgccattagcaaggac
ttcacagaggaccgcatctggctgaatggtcgcgaggaggacgtggggcagccacggctc
caggcctgcctgagagagattcgccgcctggctcggaagcggaggagcacagaggacggg
gacactctacccctcagcctcagctataaggtgcacgtggcgtcagtgaacaacttcccc
actgctgcaggcctggcgtcctcagccgcaggctatgcctgcctagcctataccctggct
caggtctatggggttgagggagacctctccgaagtggctcggcggggctcaggcagtgcg
tgccgcagtctctatgggggctttgtggagtggcagatgggggaacaggccgatgggaag
gacagcatcgcccggcagatagccccagagtggcactggccccagctccgaatccttatc
cttgtggtgagcgccgacaagaagcagacgggcagtacagtgggcatgcagaccagcgtg
gagaccagcaccctgctcaagttccgggctgagtctgttgtgcctgagcgcatgaaggag
atgacccgctgcatccaagagcaggactttcagggctttgcccagctgaccatgaaggat
agcaaccagtttcatgccacctgcctggacaccttcccaccgatctcctacctcaatgac
acctccaggcgcatcatccagctagtccaccgcttcaacacccaccaggggcagacgaag
gtggcatacacatttgatgctggccccaacgctgtgatcttcactctggaggacactgtg
gctgagtttgtggcagctgtaagacacagctttccccctgcagccaatggagacaagttc
ctaaaggggctgcaggtggcacctgttcttctctctgatgagctgaaggccgcgctggcg
gtggagcccagccctggtggggtccagtacatcattgccactcaggtcggaccaggacct
caagtcctagacgacactcatgatcatctgctaggccaggatggactgccacaacgggac
ctttga

DBGET integrated database retrieval system