KEGG   Mus musculus (mouse): 192160Help
Entry
192160            CDS       T01002                                 

Gene name
Casc3, Btz, Mln51
Definition
(RefSeq) cancer susceptibility candidate 3
  KO
K14323  
protein CASC3
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
mRNA surveillance pathway
Module
Exon junction complex (EJC)
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    192160 (Casc3)
   03015 mRNA surveillance pathway
    192160 (Casc3)
Messenger RNA biogenesis [BR:mmu03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    EJC complex
     192160 (Casc3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 D
AA seq 698 aa AA seqDB search
MADRRRQRASQDTEDEESGASGSDSGSPARGGGSCSGSVGGGGSGSLPSQRGGRGGGLHL
RRVESGGAKSAEESECESEDGMEGDAVLSDYESAEDSEGEEDYSEEENSKVELKSEANDA
ADSSAKEKGEEKPESKGTVTGERQSGDGQESTEPVENKVGKKGPKHLDDDEDRKNPAYIP
RKGLFFEHDLRGQTQEEEVRPKGRQRKLWKDEGRWEHDKFREDEQAPKSRQELIALYGYD
IRSAHNPDDIKPRRIRKPRFGSSPQRDPNWIGDRSSKSHRHQGPGGNLPPRTFINRNTAG
TGRMSASRNYSRSGGFKDGRTSFRPVEVAGQHGGRSAETLKHEASYRSRRLEQTPVRDPS
PEPDAPLLGSPEKEEVASETPAAVPDITPPAPDRPIEKKSYSRARRTRTKVGDAVKAAEE
VPPPSEGLASTATVPETTPAAKTGNWEAPVDSTTGGLEQDVAQLNIAEQSWSPSQPSFLQ
PRELRGVPNHIHMGAGPPPQFNRMEEMGVQSGRAKRYSSQRQRPVPEPPAPPVHISIMEG
HYYDPLQFQGPIYTHGDSPAPLPPQGMIVQPEMHLPHPGLHPHQSPGPLPNPGLYPPPVS
MSPGQPPPQQLLAPTYFSAPGVMNFGNPNYPYAPGALPPPPPPHLYPNTQAPPQVYGGVT
YYNPAQQQVQPKPSPPRRTPQPVSIKPPPPEVVSRGSS
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atggcggaccggcggcggcagcgcgcttcccaggacacggaggacgaggaatccggggct
tcgggttccgacagcggctctccggcgcggggcggcggcagctgcagcgggagcgtcgga
ggcggcggcagtggctcgctgccttctcagcgcggcggccgcggcgggggccttcacctg
cggcgggtggagagcgggggcgccaagagcgccgaggagtctgagtgtgagagtgaagat
ggcatggaaggagatgctgttctttccgattatgaaagtgcagaagattcagaaggtgaa
gaagactacagtgaagaggagaattccaaggtggagctgaaatcagaagctaacgatgct
gctgattcctctgcgaaagaaaagggagaggaaaagcctgagtctaaaggcacggtgact
ggggagaggcagagcggcgatgggcaggagagcacagagcctgtggagaacaaagtgggg
aaaaaaggccctaagcacttggatgacgatgaggatcggaaaaacccagcctacatcccc
aggaaagggctcttctttgagcacgatcttcgaggacagactcaggaggaggaagtccga
cccaagggacggcagcgaaagctatggaaagatgagggtcgctgggaacatgataagttc
cgtgaggatgaacaggccccgaaatctcggcaggagctaattgcactttatggttatgac
attcggtctgctcacaatcctgatgacatcaaaccccgaagaatccggaaacctcgattt
ggaagttccccacaaagagatccaaactggattggtgatcgatcaagcaaatcccatcgc
caccagggtcctgggggcaatctaccacctaggacatttattaacaggaacacggcaggt
actggccgcatgtctgcatccaggaattactctcgatctgggggcttcaaggatggccgc
actagtttcaggcctgtggaggttgctgggcagcatggtggccggtctgctgagactctt
aagcatgaagctagttaccggtcacggcgtctagagcagactcctgtgagggatccatct
ccagagccagatgctccattgcttggaagtcctgagaaagaagaggtggcctcagagacg
ccagctgctgtacccgacatcaccccaccagctcctgacaggcccattgagaagaagtcc
tattcccgggcaagaaggaccaggaccaaagttggggatgcagtcaaagctgctgaggag
gttcctcctccatctgaagggctggcctcaacagccacagtccccgaaacgactccagct
gctaagactgggaactgggaggctccagtagactctaccacaggtggacttgagcaagat
gtggcgcagctaaatatagcagaacaaagttggagtccaagccagccttcattcttgcag
ccacgggaacttcgaggtgtgcctaaccacatccacatgggagcaggacccccacctcag
tttaaccggatggaagaaatgggcgtccagagtggtcgagctaagcgttactcatcccag
cggcagagacctgtgccagagccccctgctcctcctgtgcatatcagtatcatggaggga
cattactatgatccattgcagttccagggaccaatctatacccatggtgacagccctgcc
ccactgcccccacagggcatgatcgtacagccggaaatgcaccttccccacccaggttta
catccccaccagtcaccaggacctctgcccaacccgggtctctacccaccaccagtgtcc
atgtccccaggacagccaccgccccagcaactgcttgctcctacctacttttctgctccg
ggtgtcatgaattttggtaaccccaattacccttatgctccgggagcattgccacctcct
ccacctcctcatctgtatcctaacacgcaggctccaccacaggtgtatggaggagtgact
tactataaccccgcccagcagcaggtgcagcccaagccctccccaccccggaggactccc
cagccggtctccatcaagccccccccacctgaggttgtaagcaggggttccagttaa

DBGET integrated database retrieval system