KEGG   Mus musculus (mouse): 192176Help
Entry
192176            CDS       T01002                                 

Gene name
Flna, ABP-280, Dilp2, F730004A14Rik, Fln1, GENA_379, filamin-1
Definition
filamin, alpha
Orthology
K04437  
filamin
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    192176 (Flna)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    192176 (Flna)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    192176 (Flna)
  Infectious diseases
   05132 Salmonella infection
    192176 (Flna)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   192176 (Flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X A7.3; X 37.89 cM
AA seq 1988 aa AA seqDB search
MADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSV
EATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGV
AKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYT
PCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNA
KTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKS
PFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCK
VEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQG
GNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINIL
FADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICS
EAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQ
CYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKV
EYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVE
TRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFK
VPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDV
VDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG
VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTIL
IKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAA
GKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVT
ALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI
KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFY
VDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGT
CSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETD
LSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI
SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLED
GTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANIGSH
CDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQ
HVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPS
KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS
LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGI
YLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGA
GALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGP
RLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFT
VDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPG
SPYRIMVP
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatccgtgaggcaccccaggattttcacccagacagggtgaaggcacgtggg
cctggattggagaagactggtgtggctgtcaacaagccagcagagttcacagttgatgcc
aagcatgctgggaaggctcctcttcgagttcaagttcaggacaatgagggctgctctgtg
gaagcgacagtcaaggacaatggcaatggtacttacagctgttcttatgtgcccagaaag
ccagtgaagcacacagccatggtttcttggggaggtgtcagcatccccaacagtcctttc
cgggtgaatgtgggagctggcagccatccaaacaaagtcaaggtgtatggtccaggagtg
gccaagactgggctcaaggcccatgaacctacctactttactgtggattgtactgaagct
ggccagggagatgtcagcattggtatcaagtgtgcccctggagtagtgggccccactgag
gctgatattgactttgatatcatccgcaatgacaatgacaccttcactgtaaaatacaca
ccctgtggggctggcagctataccatcatggtcctttttgctgaccaggccacacccacc
agccccatcagagtcaaagtggagccttctcatgatgccagcaaggtgaaggctgagggt
cctggcctaaatcgcactggtgttgaacttggcaaacccacccatttcacagtcaatgct
aaaactgctgggaaaggcaagctggatgtccaattctcaggactggctaagggagatgca
gtacgggatgtggacatcattgaccaccatgataatacctacacagtcaagtacattcct
gtgcagcagggcccagtaggtgtcaatgtcacttatggaggagatcacatccccaagagt
ccattttcagtgggagtatctccaagcctggatctcagcaaaatcaaggtgtctggcctt
ggtgacaaagtggacgttggcaaagatcaagagttcacagtaaagtcaaagggtgcaggt
ggtcaaggcaaagtagcatccaagattgtgagtccctcaggtgcagcggtaccctgcaag
gtagagccaggcctgggagctgacaacagcgtggtacgttttgtgccccgtgaagagggg
ccctatgaggtggaagtgacctatgatggtgtgcctgtacctggcagtccctttccacta
gaagctgtggcccccaccaaacccagcaaggtgaaggcgtttggaccagggctacagggg
ggcaatgcaggctcccctgcccgcttcaccattgatacaaagggtgctggcactggtggc
ctgggcctgacagtggaaggcccctgtgaagcacagcttgagtgcctagacaacggggat
ggtacatgctctgtgtcttatgtacccactgagcctggggactacaacatcaacatcctt
tttgctgacacccacattcctggatccccattcaaggcccatgtggctccttgttttgat
gcatccaaggtgaagtgctcaggccctgggctggagcgggctactgctggtgaggtaggg
cagttccaagtggactgttcaagtgctggcagtgctgagttgacgattgagatctgctct
gaggcaggactgccagctgaagtatacattcaagaccatggtgatggcacacacaccatt
acctatattcctctctgtcctggggcttacactgttaccatcaagtatggcggccagcct
gtgcccaacttccccagcaagctacaggtggaacctgctgtagatacctcaggtgtacag
tgctatgggcctgggattgaaggtcaaggtgtcttccgagaggcaaccactgagttcagt
gtggatgcccgggctcttacacagactggagggccacatgtcaaggctcgagtggccaac
ccctcaggcaatctgacagatacctatgtgcaagactgtggggatggcacatacaaagtg
gaatacactccatatgaggaaggagtacactctgtggatgtgacttatgatggcagccct
gtgcccagcagccccttccaggtgcctgtaacagagggctgtgacccctcccgggtgcgt
gtccatggaccaggcatccaaagtggtaccaccaacaaacccaacaagttcacagtagaa
accaggggagctggcacaggtggcctgggcttggctgttgagggtccctcagaggccaag
atgtcttgtatggataataaagatggcagctgctcagtagaatacatcccctatgaagct
ggaacctatagccttaatgtcacttatggtggtcaccaagtgccaggtagtcccttcaag
gtccctgtacatgatgtgacagatgcatctaaagtcaagtgttctggacctggcctaagc
ccaggcatggtccgtgccaacctccctcagtcctttcaggtggacacaagcaaagctgga
gttgccccactgcaggtcaaagtgcaggggcccaaaggcctggtggagccagtggatgta
gtggacaatgctgatggtactcagactgtcaactatgtgcccagccgagaagggtcctat
agcatttctgtgctgtatggtgaagaagaagtgccacggagccccttcaaggtcaaggtg
ctgcctacacatgatgccagtaaggtgaaggccagtggacctggactcaacaccactggt
gtacctgctagcctgcctgtggagttcaccattgatgccaaggatgctggggagggtctg
ttggctgtccagattacggatcctgaaggcaagcccaagaagacacacattcaagataat
catgatggcacatacacggtggcttatgtgccagatgtgccaggccggtacacaatcctc
atcaagtatggtggtgatgagattcccttttccccgtaccgtgtccgggctgtgcccact
ggggatgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggc
attggccccaccatccagattggggaggagacggtgattactgtggacacaaaagcagca
ggcaaaggcaaagtgacttgtactgtgtgcacacctgatggctcagaggtagacgtggac
gtggtggagaatgaggatggcacctttgacatcttctacacagctccccaaccgggcaaa
tatgtcatctgtgtgcgcttcggtggcgagcatgtgcccaacagccccttccaagttaca
gctttggctggggaccaaccaacagtgcagaccccattaaggtctcagcagctggctcca
cagtataactatcctcagggtagccagcaaacctggattccagagaggcccatggtgggc
gttaatgggctggatgtgaccagcctgaggccctttgatcttgtcatccccttcactatc
aagaagggggagatcactggggaagttcgaatgccctcaggcaaggtggcccagccttcc
attactgataacaaagatggcactgttactgtacgttactcacccagtgaagctggcctg
catgaaatggacattcgctatgacaatatgcatatcccaggaagccctctgcagttctat
gttgattatgtcaactgtggccacatcactgcttatggtcctggccttacccatggagtg
gtcaacaaacctgccaccttcactgtcaacaccaaggatgcaggagaggggggcttgtct
ctggccattgagggtccatctaaagcagaaatcagttgcactgacaaccaggatggaaca
tgcagtgtctcttacctgcctgtactgcctggtgactatagcatcctagttaagtacaat
gatcaacacatcccaggcagtccctttactgccagagtaacaggtgacgattccatgcgt
atgtcccacctaaaggtgggttctgctgctgatatccccatcaatatctcagaaacagac
cttagcctactcacagccactgtggtgccaccttcgggtcgagaggaaccctgtctgctg
aaacgtttgcgaaatggccacgtggggatttccttcgtgcccaaggagacaggggagcac
ctggtacatgtgaagaagaatggccagcatgtggcaagcagtcccatcccagtagtgatc
agccagtcggagataggtgatgccagccgtgtgagggtctctggtcaaggtcttcatgaa
ggtcatacctttgagcctgcagagtttattattgacaccagagatgcaggctacggtggg
cttagtctgtccattgagggccctagcaaagtagacatcaacacagaggatctggaggat
ggcacatgcagggtcacctactgtcccacagagcctggaaactacattataaacatcaaa
tttgctgaccagcatgtgcctggcagtcccttttctgtgaaggtgacaggtgagggccgg
gtgaaagagagtatcacacgcaggcgacgtgccccttctgtggccaatattggcagtcat
tgtgacctcagcctgaagattcctgaaattagcatccaagatatgacagcccaggtgacc
agcccatcaggcaagacccatgaggcagagatcgtagaaggagagaaccatacttactgt
atccgatttgtgcctgctgagatgggaatgcatacagtcagtgtcaagtacaagggccag
catgtacctgggagccccttccagttcactgtggggcctctgggggaagggggtgctcac
aaggtccgtgctggaggccctggcctagagagggctgaagttggagtgccagcggagttc
ggcatttggactagggaagctggcgctggaggcctggccattgctgttgaaggccccagc
aaggctgagatctctttcgaggaccgaaaggatggctcctgtggtgtggcctacgtagtt
caggagccaggtgactatgaggtctcagtcaagttcaacgaggagcacatacctgatagc
cccttcgtggtgcctgtggcttctccgtctggtgacgcccgccgccttactgtttctagt
cttcaggagtcagggttaaaggtcaaccagccagcatcttttgcagtcagtctgaatgga
gccaagggggcaattgatgccaaggtgcacagcccctcaggagctctggaggagtgctat
gtcacagagattgaccaagataagtatgctgtgcgtttcatcccacgagagaatggcatc
tacttgattgatgtcaagttcaatggtactcacattcctggaagtcccttcaagatccga
gttggggagcctgggcatggaggggacccaggcttagtgtccgcctatggagcaggcctg
gaaggtggtgtcacagggagcccagcagagtttattgtgaacacaagcaatgcaggagct
ggtgccctttcggttaccattgatggcccctccaaggtgaagatggattgccaggagtgc
cccgagggctatcgtgtcacctatacccccatggcacctggcagctacctcatctccatc
aagtatggtggcccctatcacattggtggaagtccctttaaagccaaggtcacaggtcct
cgtcttgtaagcaaccacagcctccatgagacatcatctgtgtttgtggactctttgact
aaagttgccacggttccccagcatgcaacctcaggcccaggtcctgctgatgtcagcaag
gtagtagccaaaggcctggggctaagcaaggcttatgtaggccagaagagcaacttcaca
gtagattgcagcaaagcaggtaacaacatgctgctggtgggcgtgcatggcccaaggaca
ccctgtgaagagatcctggtgaaacacatgggcagccgcctctatagtgtctcttacctg
ctcaaggacaaaggggagtacacactggtggtcaagtggggtgatgagcatatcccaggc
agcccataccgcattatggtaccctga

DBGET integrated database retrieval system