KEGG   Mus musculus (mouse): 192176Help
Entry
192176            CDS       T01002                                 

Gene name
Flna, ABP-280, Dilp2, F730004A14Rik, Fln1, GENA_379, filamin-1
Definition
(RefSeq) filamin, alpha
  KO
K04437  
filamin
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Focal adhesion
Salmonella infection
Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    192176 (Flna)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    192176 (Flna)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    192176 (Flna)
  Infectious diseases
   05132 Salmonella infection
    192176 (Flna)
Cytoskeleton proteins [BR:mmu04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Cross-linking proteins
     192176 (Flna)
  Intermediate filaments
   Intermediate filament-binding proteins
    192176 (Flna)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   192176 (Flna)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
Position
X A7.3; X 37.89 cM
AA seq 1988 aa AA seqDB search
MADIREAPQDFHPDRVKARGPGLEKTGVAVNKPAEFTVDAKHAGKAPLRVQVQDNEGCSV
EATVKDNGNGTYSCSYVPRKPVKHTAMVSWGGVSIPNSPFRVNVGAGSHPNKVKVYGPGV
AKTGLKAHEPTYFTVDCTEAGQGDVSIGIKCAPGVVGPTEADIDFDIIRNDNDTFTVKYT
PCGAGSYTIMVLFADQATPTSPIRVKVEPSHDASKVKAEGPGLNRTGVELGKPTHFTVNA
KTAGKGKLDVQFSGLAKGDAVRDVDIIDHHDNTYTVKYIPVQQGPVGVNVTYGGDHIPKS
PFSVGVSPSLDLSKIKVSGLGDKVDVGKDQEFTVKSKGAGGQGKVASKIVSPSGAAVPCK
VEPGLGADNSVVRFVPREEGPYEVEVTYDGVPVPGSPFPLEAVAPTKPSKVKAFGPGLQG
GNAGSPARFTIDTKGAGTGGLGLTVEGPCEAQLECLDNGDGTCSVSYVPTEPGDYNINIL
FADTHIPGSPFKAHVAPCFDASKVKCSGPGLERATAGEVGQFQVDCSSAGSAELTIEICS
EAGLPAEVYIQDHGDGTHTITYIPLCPGAYTVTIKYGGQPVPNFPSKLQVEPAVDTSGVQ
CYGPGIEGQGVFREATTEFSVDARALTQTGGPHVKARVANPSGNLTDTYVQDCGDGTYKV
EYTPYEEGVHSVDVTYDGSPVPSSPFQVPVTEGCDPSRVRVHGPGIQSGTTNKPNKFTVE
TRGAGTGGLGLAVEGPSEAKMSCMDNKDGSCSVEYIPYEAGTYSLNVTYGGHQVPGSPFK
VPVHDVTDASKVKCSGPGLSPGMVRANLPQSFQVDTSKAGVAPLQVKVQGPKGLVEPVDV
VDNADGTQTVNYVPSREGSYSISVLYGEEEVPRSPFKVKVLPTHDASKVKASGPGLNTTG
VPASLPVEFTIDAKDAGEGLLAVQITDPEGKPKKTHIQDNHDGTYTVAYVPDVPGRYTIL
IKYGGDEIPFSPYRVRAVPTGDASKCTVTVSIGGHGLGAGIGPTIQIGEETVITVDTKAA
GKGKVTCTVCTPDGSEVDVDVVENEDGTFDIFYTAPQPGKYVICVRFGGEHVPNSPFQVT
ALAGDQPTVQTPLRSQQLAPQYNYPQGSQQTWIPERPMVGVNGLDVTSLRPFDLVIPFTI
KKGEITGEVRMPSGKVAQPSITDNKDGTVTVRYSPSEAGLHEMDIRYDNMHIPGSPLQFY
VDYVNCGHITAYGPGLTHGVVNKPATFTVNTKDAGEGGLSLAIEGPSKAEISCTDNQDGT
CSVSYLPVLPGDYSILVKYNDQHIPGSPFTARVTGDDSMRMSHLKVGSAADIPINISETD
LSLLTATVVPPSGREEPCLLKRLRNGHVGISFVPKETGEHLVHVKKNGQHVASSPIPVVI
SQSEIGDASRVRVSGQGLHEGHTFEPAEFIIDTRDAGYGGLSLSIEGPSKVDINTEDLED
GTCRVTYCPTEPGNYIINIKFADQHVPGSPFSVKVTGEGRVKESITRRRRAPSVANIGSH
CDLSLKIPEISIQDMTAQVTSPSGKTHEAEIVEGENHTYCIRFVPAEMGMHTVSVKYKGQ
HVPGSPFQFTVGPLGEGGAHKVRAGGPGLERAEVGVPAEFGIWTREAGAGGLAIAVEGPS
KAEISFEDRKDGSCGVAYVVQEPGDYEVSVKFNEEHIPDSPFVVPVASPSGDARRLTVSS
LQESGLKVNQPASFAVSLNGAKGAIDAKVHSPSGALEECYVTEIDQDKYAVRFIPRENGI
YLIDVKFNGTHIPGSPFKIRVGEPGHGGDPGLVSAYGAGLEGGVTGSPAEFIVNTSNAGA
GALSVTIDGPSKVKMDCQECPEGYRVTYTPMAPGSYLISIKYGGPYHIGGSPFKAKVTGP
RLVSNHSLHETSSVFVDSLTKVATVPQHATSGPGPADVSKVVAKGLGLSKAYVGQKSNFT
VDCSKAGNNMLLVGVHGPRTPCEEILVKHMGSRLYSVSYLLKDKGEYTLVVKWGDEHIPG
SPYRIMVP
NT seq 5967 nt NT seq  +upstreamnt  +downstreamnt
atggctgacatccgtgaggcaccccaggattttcacccagacagggtgaaggcacgtggg
cctggattggagaagactggtgtggctgtcaacaagccagcagagttcacagttgatgcc
aagcatgctgggaaggctcctcttcgagttcaagttcaggacaatgagggctgctctgtg
gaagcgacagtcaaggacaatggcaatggtacttacagctgttcttatgtgcccagaaag
ccagtgaagcacacagccatggtttcttggggaggtgtcagcatccccaacagtcctttc
cgggtgaatgtgggagctggcagccatccaaacaaagtcaaggtgtatggtccaggagtg
gccaagactgggctcaaggcccatgaacctacctactttactgtggattgtactgaagct
ggccagggagatgtcagcattggtatcaagtgtgcccctggagtagtgggccccactgag
gctgatattgactttgatatcatccgcaatgacaatgacaccttcactgtaaaatacaca
ccctgtggggctggcagctataccatcatggtcctttttgctgaccaggccacacccacc
agccccatcagagtcaaagtggagccttctcatgatgccagcaaggtgaaggctgagggt
cctggcctaaatcgcactggtgttgaacttggcaaacccacccatttcacagtcaatgct
aaaactgctgggaaaggcaagctggatgtccaattctcaggactggctaagggagatgca
gtacgggatgtggacatcattgaccaccatgataatacctacacagtcaagtacattcct
gtgcagcagggcccagtaggtgtcaatgtcacttatggaggagatcacatccccaagagt
ccattttcagtgggagtatctccaagcctggatctcagcaaaatcaaggtgtctggcctt
ggtgacaaagtggacgttggcaaagatcaagagttcacagtaaagtcaaagggtgcaggt
ggtcaaggcaaagtagcatccaagattgtgagtccctcaggtgcagcggtaccctgcaag
gtagagccaggcctgggagctgacaacagcgtggtacgttttgtgccccgtgaagagggg
ccctatgaggtggaagtgacctatgatggtgtgcctgtacctggcagtccctttccacta
gaagctgtggcccccaccaaacccagcaaggtgaaggcgtttggaccagggctacagggg
ggcaatgcaggctcccctgcccgcttcaccattgatacaaagggtgctggcactggtggc
ctgggcctgacagtggaaggcccctgtgaagcacagcttgagtgcctagacaacggggat
ggtacatgctctgtgtcttatgtacccactgagcctggggactacaacatcaacatcctt
tttgctgacacccacattcctggatccccattcaaggcccatgtggctccttgttttgat
gcatccaaggtgaagtgctcaggccctgggctggagcgggctactgctggtgaggtaggg
cagttccaagtggactgttcaagtgctggcagtgctgagttgacgattgagatctgctct
gaggcaggactgccagctgaagtatacattcaagaccatggtgatggcacacacaccatt
acctatattcctctctgtcctggggcttacactgttaccatcaagtatggcggccagcct
gtgcccaacttccccagcaagctacaggtggaacctgctgtagatacctcaggtgtacag
tgctatgggcctgggattgaaggtcaaggtgtcttccgagaggcaaccactgagttcagt
gtggatgcccgggctcttacacagactggagggccacatgtcaaggctcgagtggccaac
ccctcaggcaatctgacagatacctatgtgcaagactgtggggatggcacatacaaagtg
gaatacactccatatgaggaaggagtacactctgtggatgtgacttatgatggcagccct
gtgcccagcagccccttccaggtgcctgtaacagagggctgtgacccctcccgggtgcgt
gtccatggaccaggcatccaaagtggtaccaccaacaaacccaacaagttcacagtagaa
accaggggagctggcacaggtggcctgggcttggctgttgagggtccctcagaggccaag
atgtcttgtatggataataaagatggcagctgctcagtagaatacatcccctatgaagct
ggaacctatagccttaatgtcacttatggtggtcaccaagtgccaggtagtcccttcaag
gtccctgtacatgatgtgacagatgcatctaaagtcaagtgttctggacctggcctaagc
ccaggcatggtccgtgccaacctccctcagtcctttcaggtggacacaagcaaagctgga
gttgccccactgcaggtcaaagtgcaggggcccaaaggcctggtggagccagtggatgta
gtggacaatgctgatggtactcagactgtcaactatgtgcccagccgagaagggtcctat
agcatttctgtgctgtatggtgaagaagaagtgccacggagccccttcaaggtcaaggtg
ctgcctacacatgatgccagtaaggtgaaggccagtggacctggactcaacaccactggt
gtacctgctagcctgcctgtggagttcaccattgatgccaaggatgctggggagggtctg
ttggctgtccagattacggatcctgaaggcaagcccaagaagacacacattcaagataat
catgatggcacatacacggtggcttatgtgccagatgtgccaggccggtacacaatcctc
atcaagtatggtggtgatgagattcccttttccccgtaccgtgtccgggctgtgcccact
ggggatgccagcaagtgcacagtcacagtgtcaatcggaggtcacgggctaggtgctggc
attggccccaccatccagattggggaggagacggtgattactgtggacacaaaagcagca
ggcaaaggcaaagtgacttgtactgtgtgcacacctgatggctcagaggtagacgtggac
gtggtggagaatgaggatggcacctttgacatcttctacacagctccccaaccgggcaaa
tatgtcatctgtgtgcgcttcggtggcgagcatgtgcccaacagccccttccaagttaca
gctttggctggggaccaaccaacagtgcagaccccattaaggtctcagcagctggctcca
cagtataactatcctcagggtagccagcaaacctggattccagagaggcccatggtgggc
gttaatgggctggatgtgaccagcctgaggccctttgatcttgtcatccccttcactatc
aagaagggggagatcactggggaagttcgaatgccctcaggcaaggtggcccagccttcc
attactgataacaaagatggcactgttactgtacgttactcacccagtgaagctggcctg
catgaaatggacattcgctatgacaatatgcatatcccaggaagccctctgcagttctat
gttgattatgtcaactgtggccacatcactgcttatggtcctggccttacccatggagtg
gtcaacaaacctgccaccttcactgtcaacaccaaggatgcaggagaggggggcttgtct
ctggccattgagggtccatctaaagcagaaatcagttgcactgacaaccaggatggaaca
tgcagtgtctcttacctgcctgtactgcctggtgactatagcatcctagttaagtacaat
gatcaacacatcccaggcagtccctttactgccagagtaacaggtgacgattccatgcgt
atgtcccacctaaaggtgggttctgctgctgatatccccatcaatatctcagaaacagac
cttagcctactcacagccactgtggtgccaccttcgggtcgagaggaaccctgtctgctg
aaacgtttgcgaaatggccacgtggggatttccttcgtgcccaaggagacaggggagcac
ctggtacatgtgaagaagaatggccagcatgtggcaagcagtcccatcccagtagtgatc
agccagtcggagataggtgatgccagccgtgtgagggtctctggtcaaggtcttcatgaa
ggtcatacctttgagcctgcagagtttattattgacaccagagatgcaggctacggtggg
cttagtctgtccattgagggccctagcaaagtagacatcaacacagaggatctggaggat
ggcacatgcagggtcacctactgtcccacagagcctggaaactacattataaacatcaaa
tttgctgaccagcatgtgcctggcagtcccttttctgtgaaggtgacaggtgagggccgg
gtgaaagagagtatcacacgcaggcgacgtgccccttctgtggccaatattggcagtcat
tgtgacctcagcctgaagattcctgaaattagcatccaagatatgacagcccaggtgacc
agcccatcaggcaagacccatgaggcagagatcgtagaaggagagaaccatacttactgt
atccgatttgtgcctgctgagatgggaatgcatacagtcagtgtcaagtacaagggccag
catgtacctgggagccccttccagttcactgtggggcctctgggggaagggggtgctcac
aaggtccgtgctggaggccctggcctagagagggctgaagttggagtgccagcggagttc
ggcatttggactagggaagctggcgctggaggcctggccattgctgttgaaggccccagc
aaggctgagatctctttcgaggaccgaaaggatggctcctgtggtgtggcctacgtagtt
caggagccaggtgactatgaggtctcagtcaagttcaacgaggagcacatacctgatagc
cccttcgtggtgcctgtggcttctccgtctggtgacgcccgccgccttactgtttctagt
cttcaggagtcagggttaaaggtcaaccagccagcatcttttgcagtcagtctgaatgga
gccaagggggcaattgatgccaaggtgcacagcccctcaggagctctggaggagtgctat
gtcacagagattgaccaagataagtatgctgtgcgtttcatcccacgagagaatggcatc
tacttgattgatgtcaagttcaatggtactcacattcctggaagtcccttcaagatccga
gttggggagcctgggcatggaggggacccaggcttagtgtccgcctatggagcaggcctg
gaaggtggtgtcacagggagcccagcagagtttattgtgaacacaagcaatgcaggagct
ggtgccctttcggttaccattgatggcccctccaaggtgaagatggattgccaggagtgc
cccgagggctatcgtgtcacctatacccccatggcacctggcagctacctcatctccatc
aagtatggtggcccctatcacattggtggaagtccctttaaagccaaggtcacaggtcct
cgtcttgtaagcaaccacagcctccatgagacatcatctgtgtttgtggactctttgact
aaagttgccacggttccccagcatgcaacctcaggcccaggtcctgctgatgtcagcaag
gtagtagccaaaggcctggggctaagcaaggcttatgtaggccagaagagcaacttcaca
gtagattgcagcaaagcaggtaacaacatgctgctggtgggcgtgcatggcccaaggaca
ccctgtgaagagatcctggtgaaacacatgggcagccgcctctatagtgtctcttacctg
ctcaaggacaaaggggagtacacactggtggtcaagtggggtgatgagcatatcccaggc
agcccataccgcattatggtaccctga

DBGET integrated database retrieval system