KEGG   Mus musculus (mouse): 19220Help
Entry
19220             CDS       T01002                                 

Gene name
Ptgfr, AI957154, PGF, fp
Definition
(RefSeq) prostaglandin F receptor
  KO
K04262  
prostaglandin F receptor
Organism
mmu  Mus musculus (mouse)
Pathway
Calcium signaling pathway
Phospholipase D signaling pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    19220 (Ptgfr)
   04072 Phospholipase D signaling pathway
    19220 (Ptgfr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19220 (Ptgfr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    19220 (Ptgfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
3 H3; 3 76.96 cM
AA seq 366 aa AA seqDB search
MSMNSSKQPVSPAAGLIANTTCQTENRLSVFFSIIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGGIAVFVYASDKDWIRFDQSNILCSIFGISMVFSGL
CPLFLGSAMAIERCIGVTNPIFHSTKITSKHVKMILSGVCMFAVFVAVLPILGHRDYQIQ
ASRTWCFYNTEHIEDWEDRFYLLFFSFLGLLALGVSFSCNAVTGVTLLRVKFRSQQHRQG
RSHHLEMIIQLLAIMCVSCVCWSPFLVTMANIAINGNNSPVTCETTLFALRMATWNQILD
PWVYILLRKAVLRNLYKLASRCCGVNIISLHIWELSSIKNSLKVAAISESPAAEKESQQA
SSEAGL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaacagttccaagcagccagtgtctcctgcagctggactcatcgcaaacaca
acctgccagacggagaaccggctttcagtatttttttctatcatcttcatgacagtgggg
atcttatcgaacagcctggccatcgccattctcatgaaggcctaccagagatttagacag
aagtcaaaggcttccttcctgcttttggctagtggcctggtgatcacagacttctttggc
caccttatcaacggaggcatagctgtctttgtatatgcttctgataaagactggatccgc
tttgatcagtcaaacatcctgtgcagtatttttggaatctccatggtcttttctggcttg
tgcccactttttctaggcagtgcgatggccatcgagaggtgtataggagtcaccaatcct
atatttcactctacgaagatcacatctaaacacgtgaaaatgatcctgagtggtgtgtgc
atgtttgctgtgttcgtggctgtgctgcccatccttggacaccgagattatcaaatccaa
gcgtccagaacctggtgtttctacaacacagagcacatcgaagactgggaagacagattt
tatctcctgttcttttctttcctcggactcttagctcttggtgtttccttctcgtgcaat
gccgtcacgggagtcacactcttaagagtgaagttcagaagccagcagcataggcaaggc
agatctcaccacctggagatgatcattcagctcctggccataatgtgcgtctcctgcgtc
tgctggagtccctttctggtaacaatggccaacattgcaataaatggaaataattcccca
gtgacctgtgaaacgacactttttgctctccgcatggcaacgtggaatcagatcttagat
ccctgggtctatattctgctacggaaggctgtccttaggaacctgtataaacttgccagt
cgttgctgtggagttaacatcatcagcttgcatatctgggaactcagctccatcaagaat
tccttaaaggttgctgctatttctgagtcaccagctgcagagaaggagagccagcaagca
tcgagtgaagctggactgtaa

DBGET integrated database retrieval system