KEGG   Mus musculus (mouse): 19220Help
Entry
19220             CDS       T01002                                 

Gene name
Ptgfr, AI957154, PGF, fp
Definition
(RefSeq) prostaglandin F receptor
  KO
K04262  prostaglandin F receptor
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04020  Calcium signaling pathway
mmu04072  Phospholipase D signaling pathway
mmu04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    19220 (Ptgfr)
   04072 Phospholipase D signaling pathway
    19220 (Ptgfr)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19220 (Ptgfr)
G protein-coupled receptors [BR:mmu04030]
 Class A. Rhodopsin family
  Lipid
   Prostaglandin
    19220 (Ptgfr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Sri Serpentine_r_xa
Motif
Other DBs
NCBI-GeneID: 19220
NCBI-ProteinID: NP_032992
MGI: 97796
Ensembl: ENSMUSG00000028036
Vega: OTTMUSG00000025720
UniProt: P43117 Q60I90 Q8BNT7
Position
3 H3; 3 76.96 cM
AA seq 366 aa AA seqDB search
MSMNSSKQPVSPAAGLIANTTCQTENRLSVFFSIIFMTVGILSNSLAIAILMKAYQRFRQ
KSKASFLLLASGLVITDFFGHLINGGIAVFVYASDKDWIRFDQSNILCSIFGISMVFSGL
CPLFLGSAMAIERCIGVTNPIFHSTKITSKHVKMILSGVCMFAVFVAVLPILGHRDYQIQ
ASRTWCFYNTEHIEDWEDRFYLLFFSFLGLLALGVSFSCNAVTGVTLLRVKFRSQQHRQG
RSHHLEMIIQLLAIMCVSCVCWSPFLVTMANIAINGNNSPVTCETTLFALRMATWNQILD
PWVYILLRKAVLRNLYKLASRCCGVNIISLHIWELSSIKNSLKVAAISESPAAEKESQQA
SSEAGL
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgtctatgaacagttccaagcagccagtgtctcctgcagctggactcatcgcaaacaca
acctgccagacggagaaccggctttcagtatttttttctatcatcttcatgacagtgggg
atcttatcgaacagcctggccatcgccattctcatgaaggcctaccagagatttagacag
aagtcaaaggcttccttcctgcttttggctagtggcctggtgatcacagacttctttggc
caccttatcaacggaggcatagctgtctttgtatatgcttctgataaagactggatccgc
tttgatcagtcaaacatcctgtgcagtatttttggaatctccatggtcttttctggcttg
tgcccactttttctaggcagtgcgatggccatcgagaggtgtataggagtcaccaatcct
atatttcactctacgaagatcacatctaaacacgtgaaaatgatcctgagtggtgtgtgc
atgtttgctgtgttcgtggctgtgctgcccatccttggacaccgagattatcaaatccaa
gcgtccagaacctggtgtttctacaacacagagcacatcgaagactgggaagacagattt
tatctcctgttcttttctttcctcggactcttagctcttggtgtttccttctcgtgcaat
gccgtcacgggagtcacactcttaagagtgaagttcagaagccagcagcataggcaaggc
agatctcaccacctggagatgatcattcagctcctggccataatgtgcgtctcctgcgtc
tgctggagtccctttctggtaacaatggccaacattgcaataaatggaaataattcccca
gtgacctgtgaaacgacactttttgctctccgcatggcaacgtggaatcagatcttagat
ccctgggtctatattctgctacggaaggctgtccttaggaacctgtataaacttgccagt
cgttgctgtggagttaacatcatcagcttgcatatctgggaactcagctccatcaagaat
tccttaaaggttgctgctatttctgagtcaccagctgcagagaaggagagccagcaagca
tcgagtgaagctggactgtaa

DBGET integrated database retrieval system