KEGG   Mus musculus (mouse): 19228Help
Entry
19228             CDS       T01002                                 

Gene name
Pth1r, PPR, Pthr, Pthr1
Definition
(RefSeq) parathyroid hormone 1 receptor
  KO
K04585  
parathyroid hormone receptor 1
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Endocrine and other factor-regulated calcium reabsorption
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    19228 (Pth1r)
 Organismal Systems
  Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    19228 (Pth1r)
G protein-coupled receptors [BR:mmu04030]
 Class B. Secretin receptor family
  Calcium-regulating peptide
   Parathyroid hormone
    19228 (Pth1r)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 60.56 cM; 9 F
AA seq 591 aa AA seqDB search
MGTARIAPSLALLLCCPVLSSAYALVDADDVFTKEEQIFLLHRAQAQCDKLLKEVLHTAA
NIMESDKGWTPASTSGKPRKEKAPGKFYPESKENKDVPTGSRRRGRPCLPEWDNIVCWPL
GAPGEVVAVPCPDYIYDFNHKGHAYRRCDRNGSWEVVPGHNRTWANYSECLKFMTNETRE
REVFDRLGMIYTVGYSMSLASLTVAVLILAYFRRLHCTRNYIHMHMFLSFMLRAASIFVK
DAVLYSGFTLDEAERLTEEELHIIAQVPPPPAAAAVGYAGCRVAVTFFLYFLATNYYWIL
VEGLYLHSLIFMAFFSEKKYLWGFTIFGWGLPAVFVAVWVGVRATLANTGCWDLSSGHKK
WIIQVPILASVVLNFILFINIIRVLATKLRETNAGRCDTRQQYRKLLRSTLVLVPLFGVH
YTVFMALPYTEVSGTLWQIQMHYEMLFNSFQGFFVAIIYCFCNGEVQAEIRKSWSRWTLA
LDFKRKARSGSSSYSYGPMVSHTSVTNVGPRAGLSLPLSPRLLPATTNGHSQLPGHAKPG
APAIENETIPVTMTVPKDDGFLNGSCSGLDEEASGSARPPPLLQEEWETVM
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
atggggaccgcccggatcgcacccagcctggcgctccttctctgctgcccagtgctcagc
tccgcatatgcgctggtggacgcagacgatgtctttaccaaagaggaacagattttcctg
ctgcaccgtgcccaggcgcaatgtgacaagctgctcaaggaagttctgcacacagcagcc
aacataatggagtcagacaaagggtggacgccagcatctacgtcagggaagcccaggaaa
gagaaggcaccgggaaagttctaccccgagtctaaagagaacaaggatgtgcccaccggc
agcaggcgccgagggcgtccctgtctgccagagtgggacaacatcgtttgctggccattg
ggggcaccaggtgaagtggtggcagtaccttgtcccgattacatttatgacttcaaccac
aaaggccatgcctacagacgctgcgaccgcaatggcagctgggaggtggttccagggcac
aaccggacgtgggccaactacagcgagtgcctcaagttcatgaccaatgagactcgggaa
cgggaggtatttgaccgcctgggcatgatctacaccgtgggatattccatgtctcttgcc
tccctcaccgtggctgtgctcatcctagcctattttaggcggctgcactgcacgcgcaac
tacatccacatgcacatgttcctgtcgtttatgctgcgcgccgcgagcatcttcgtgaag
gacgctgtgctctactctggcttcacgctggatgaggccgagcgcctcacggaggaagag
ttgcatatcatcgcgcaggtgccgcctccgcccgccgctgccgccgttggctacgctggc
tgccgtgtggccgtgaccttcttcctctacttcctggctaccaactactactggattctg
gtggagggactgtacttacacagcctcatcttcatggcctttttctcagagaagaagtat
ctgtggggcttcaccatctttggctggggtctgccggctgtcttcgtggctgtgtgggtc
ggtgtcagagcaaccttggccaacactgggtgctgggacctgagctctgggcacaagaag
tggatcatccaggtgcccatcctggcatctgttgtgctcaacttcatcctctttatcaac
atcatccgggtgcttgccactaagcttcgggagaccaatgcgggccggtgtgacaccagg
cagcagtaccggaagctgctcaggtccacgttggtgcttgtgccactcttcggtgtccac
tacaccgtcttcatggccttgccgtacaccgaggtctcagggacactgtggcagatccag
atgcactatgagatgctcttcaactccttccagggattttttgttgccatcatatactgt
ttctgcaatggtgaggtgcaggcagagattaggaagtcttggagccgctggacactggca
ttggacttcaagcgtaaagcacgaagtgggagtagcagctacagctatggcccaatggtg
tcacacacgagtgtgaccaatgtgggcccccgtgcaggactcagccttccccttagcccc
cgcctgcttcctgccaccaccaatggccactcccagctgcctggccacgccaagccgggc
gctccagccattgagaacgaaaccataccagttactatgacagttcccaaggacgacggc
ttccttaatggctcctgctcgggtctggatgaggaggcctctgggtctgcgcggccacct
ccattgttgcaggaagaatgggaaacagtcatgtga

DBGET integrated database retrieval system