KEGG   Mus musculus (mouse): 19230Help
Entry
19230             CDS       T01002                                 

Gene name
Twf1, A6, Ptk9, twinfilin
Definition
(RefSeq) twinfilin actin binding protein 1
  KO
K08870  
twinfilin
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
15; 15 F1
AA seq 350 aa AA seqDB search
MSHQTGIQASEDVKEIFARARNGKYRLLKISIENEQLVVGSCSPPSDSWEQDYDSFVLPL
LEDKQPCYVLFRLDSQNAQGYEWIFIAWSPDHSHVRQKMLYAATRATLKKEFGGGHIKDE
VFGTVKEDVSLHGYKKYLLSQSSPAPLTAAEEELRQIKINEVQTDVSVDTKHQTLQGVAF
PISRDAFQALEKLSKKQLNYVQLEIDIKNETIILANTENTELRDLPKRIPKDSARYHFFL
YKHSHEGDYLESVVFIYSMPGYTCSIRERMLYSSCKSPLLEIVERQLQMDVIRKIEIDNG
DELTADFLYDEVHPKQHAHKQSFAKPKGPAGKRGIRRLIRGPAEAEATTD
NT seq 1053 nt NT seq  +upstreamnt  +downstreamnt
atgtcccaccagacaggcatccaagcaagcgaagatgtcaaagagatctttgcccgagcc
agaaacgggaaatacagacttctgaaaatatctatcgaaaatgagcaactggtggttggc
tcctgtagtccaccttcagactcctgggaacaggactacgactcctttgtcttgcccctg
ctggaggacaagcagccgtgctatgtattattcaggttagactctcagaatgcccaggga
tatgaatggatattcattgcatggtctccagatcattctcatgtacgtcagaaaatgctg
tatgcggcaacaagagcgactctgaagaaagaatttggaggtggccacattaaagatgaa
gtgtttggaacagtaaaggaggacgtatcattacatggatataaaaagtatttgctgtcc
cagtcttcccctgccccgctgaccgccgctgaggaagaattacggcagattaaaatcaac
gaggtccaaactgatgtgagtgtggacacaaagcaccagacactccaaggcgtagccttt
cctatttctcgagatgccttccaggctttggagaagctgagtaagaagcagctcaactat
gtgcagttggaaatagatataaaaaatgaaacaataattttggccaacacagaaaataca
gaactgagagatttgccaaagaggattcccaaggattcagcgcgttaccatttctttctg
tacaagcattcccacgaaggagactacttagagtccgtagtttttatttattcgatgcct
ggatacacgtgcagcataagagagcggatgctgtattccagctgcaagagccctctgctc
gagattgtagagcgacagctacagatggatgtgatcagaaagattgagatagacaatggg
gatgagctgactgcggatttcctgtacgatgaagtccaccccaagcagcatgcacataag
cagagttttgctaaaccgaaaggtcctgcgggaaagagggggatccgaagattgattagg
ggcccagcggaagcagaagccactactgactag

DBGET integrated database retrieval system