KEGG   Mus musculus (mouse): 19241Help
Entry
19241             CDS       T01002                                 

Gene name
Tmsb4x, Ptmb4, Tb4
Definition
thymosin, beta 4, X chromosome
Orthology
K05764  
thymosin, beta 4
Organism
mmu  Mus musculus (mouse)
Pathway
Regulation of actin cytoskeleton
Class
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:mmu04810]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
X F5; X 78.28 cM
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagatcgagaaattcgataagtcgaagttgaagaaa
acagaaacgcaagagaaaaatcctctgccttcaaaagaaacaattgaacaagagaagcaa
gctggcgaatcgtaa

DBGET integrated database retrieval system