KEGG   Mus musculus (mouse): 19246Help
Entry
19246             CDS       T01002                                 

Gene name
Ptpn1, PTP-1B, PTP-HA2, PTP1B
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 1
  KO
K05696  
tyrosine-protein phosphatase non-receptor type 1 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Insulin signaling pathway
Insulin resistance
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular community - eukaryotes
   04520 Adherens junction
    19246 (Ptpn1)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    19246 (Ptpn1)
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    19246 (Ptpn1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19246 (Ptpn1)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    19246 (Ptpn1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 H3
AA seq 432 aa AA seqDB search
MEMEKEFEEIDKAGNWAAIYQDIRHEASDFPCKVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRIMEKGSLK
CAQYWPQQEEKEMVFDDTGLKLTLISEDVKSYYTVRQLELENLTTKETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSLEHGPIVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRRFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSREDLD
LPPEHVPPPPRPPKRTLEPHNGKCKELFSSHQWVSEETCGDEDSLAREEGRAQSSAMHSV
SSMSPDTEVRRRMVGGGLQSAQASVPTEEELSSTEEEHKAHWPSHWKPFLVNVCMATLLA
TGAYLCYRVCFH
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atggagatggagaaggagttcgaggagatcgacaaggctgggaactgggcggctatttac
caggacattcgacatgaagccagcgacttcccatgcaaagtcgcgaagcttcctaagaac
aaaaaccggaacaggtaccgagatgtcagcccttttgaccacagtcggattaaattgcac
caggaagataatgactatatcaatgccagcttgataaaaatggaagaagcccagaggagc
tatattctcacccagggccctttaccaaacacatgtgggcacttctgggagatggtgtgg
gagcagaagagcaggggcgtggtcatgctcaaccgcatcatggagaaaggctcgttaaaa
tgtgcccagtattggccacagcaagaagaaaaggagatggtctttgatgacacaggtttg
aagttgacactaatctctgaagatgtcaagtcatattacacagtacgacagttggagttg
gaaaacctgactaccaaggagactcgagagatcctgcatttccactacaccacatggcct
gactttggagtccccgagtcaccggcttctttcctcaatttccttttcaaagtccgagag
tcaggctcactcagcctggagcatggccccattgtggtccactgcagcgccggcatcggg
aggtcagggaccttctgtctggctgacacctgcctcttactgatggacaagaggaaagac
ccatcttccgtggacatcaagaaagtactgctggagatgcgcaggttccgcatggggctc
atccagactgccgaccagctgcgcttctcctacctggctgtcatcgagggcgccaagttc
atcatgggcgactcgtcagtgcaggatcagtggaaggagctctcccgggaggatctagac
cttccacccgagcacgtgcccccacctccccggccacccaaacgcacactggagcctcac
aacgggaagtgcaaggagctcttctccagccaccagtgggtgagcgaggagacctgtggg
gatgaagacagcctggccagagaggaaggcagagcccagtcaagtgccatgcacagcgtg
agcagcatgagtccagacactgaagttaggagacggatggtgggtggaggtcttcaaagt
gctcaggcgtctgtccccaccgaggaagagctgtcctccactgaggaggaacacaaggca
cattggccaagtcactggaagcccttcctggtcaatgtgtgcatggccacgctcctggcc
accggcgcgtacttgtgctaccgggtgtgttttcactga

DBGET integrated database retrieval system