KEGG   Mus musculus (mouse): 19255Help
Entry
19255             CDS       T01002                                 

Gene name
Ptpn2, AI325124, Ptpt, TC-PTP
Definition
(RefSeq) protein tyrosine phosphatase, non-receptor type 2 (EC:3.1.3.48)
  KO
K18026  
tyrosine-protein phosphatase non-receptor type 2 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Jak-STAT signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    19255 (Ptpn2)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19255 (Ptpn2)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    19255 (Ptpn2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
18; 18 E1
AA seq 406 aa AA seqDB search
MSATIEREFEELDAQCRWQPLYLEIRNESHDYPHRVAKFPENRNRNRYRDVSPYDHSRVK
LQSTENDYINASLVDIEEAQRSYILTQGPLPNTCCHFWLMVWQQKTKAVVMLNRTVEKES
VKCAQYWPTDDREMVFKETGFSVKLLSEDVKSYYTVHLLQLENINTGETRTISHFHYTTW
PDFGVPESPASFLNFLFKVRESGCLTPDHGPAVIHCSAGIGRSGTFSLVDTCLVLMEKGE
DVNVKQLLLNMRKYRMGLIQTPDQLRFSYMAIIEGAKYTKGDSNIQKRWKELSKEDLSPI
CDHSQNRVMVEKYNGKRIGSEDEKLTGLPSKVQDTVEESSESILRKRIREDRKATTAQKV
QQMKQRLNETERKRKRWLYWQPILTKMGFVSVILVGALVGWTLLFH
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcaaccatcgagcgggagttcgaggaactggatgctcagtgtcgctggcagccg
ttatacttggaaattcgaaatgaatcccatgactatcctcatagagtggccaagtttcca
gaaaacagaaaccgaaacagatacagagatgtaagcccatatgatcacagtcgtgttaaa
ctgcaaagtactgaaaatgattatattaatgccagcttagttgacatagaagaggcacaa
agaagttacatcttaacacagggcccacttccgaacacatgctgccatttctggctcatg
gtgtggcagcaaaagaccaaagcagttgtcatgctaaaccgaactgtagaaaaagaatcg
gttaaatgtgcacagtactggccaacggatgacagagaaatggtgtttaaggaaacggga
ttcagtgtgaagctcttatctgaagatgtaaaatcatattatacagtacatctactacag
ttagaaaatatcaatactggtgaaaccagaaccatatctcacttccattataccacctgg
ccagattttggggttccagagtcaccagcttcatttctaaacttcttgtttaaagttaga
gaatctggttgtttgacccctgaccatggacctgcagtgatccattgcagtgcgggcatc
gggcgctctggcaccttctctcttgtagatacctgtcttgttctgatggaaaaaggagag
gatgttaatgtgaaacaattattactgaatatgagaaagtatcgaatgggacttattcag
acaccggaccaactcagattctcctacatggccataatagaaggagcaaagtacacaaaa
ggagattcaaatatacagaaacggtggaaagaactttctaaagaagatttatctcctatt
tgtgatcattcacagaacagagtgatggttgagaagtacaatgggaagagaataggttca
gaagatgaaaagttaacagggcttccttctaaggtgcaggatactgtggaggagagcagt
gagagcattctacggaaacgtattcgagaggatagaaaggctacgacggctcagaaggtg
cagcagatgaaacagaggctaaatgaaactgaacgaaaaagaaaaaggtggttatattgg
caacctattctcactaagatggggtttgtgtcagtcattttggttggcgctttggttggc
tggacactgctttttcactaa

DBGET integrated database retrieval system