KEGG   Mus musculus (mouse): 19259Help
Entry
19259             CDS       T01002                                 

Gene name
Ptpn5, Step
Definition
protein tyrosine phosphatase, non-receptor type 5 (EC:3.1.3.48)
Orthology
K18018  
tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    19259 (Ptpn5)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19259 (Ptpn5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
7 B3-B5; 7 30.7 cM
AA seq 541 aa AA seqDB search
MCCSERLLGLPQPVEMEAPDEAEGLPSKQKEMPPPPPPSPPSEPAQKLPPQGAGSHSLTV
RSSLCLFAASQFLLACGVLWLSGHGHSWLQNTTDLISSSLTVLNHLGPVAWLGSGTWGIP
SLLLVSLTVSLVIVTTLVWHLLKAPPEPPAPLPPEDRRQSVSRQPSFTYSEWMEEKVEDD
FLDLDAVPETPVFDCVMDIKPETDPASLTVKSMGLQERRGSNVSLTLDMCTPGCNEEGFG
YLVSPREESAHEYLLSASRVLRAEELHEKALDPFLLQAEFFEIPMNFVDPKEYDIPGLVR
KNRYKTILPNPHSRVRLTSPDPEDPLSSYINANYIRGYSGEEKVYIATQGPIVSTVADFW
RMVWQERTPIIVMITNIEEMNEKCTEYWPEEQVVHDGVEITVQKVIHTEDYRLRLISLRR
GTEERSLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAAQQEGPHCSPIIVHCSAGIGRTG
CFIATSICCQQLRREGVVDILKTTCQLRQDRGGMIQTCEQYQFVHHAMSLYEKQLSLQSS
E
NT seq 1626 nt NT seq  +upstreamnt  +downstreamnt
atgtgctgtagtgagaggctgttgggtctcccccagccggtagagatggaagcaccggac
gaggccgaaggactccccagcaagcagaaagagatgccaccacccccgccaccctcaccg
ccctctgagccagctcagaagctgccacctcaaggcgctgggagccactccctcaccgtc
agaagcagcctgtgcctgtttgctgcctctcagttcctgcttgcctgtggggtgctctgg
ctcagtggccatggccactcctggctgcagaacaccacagacctcatctcctcctcgctc
acagtgttgaaccatctgggacctgtggcctggctgggttctgggacctgggggatacca
agtctgctgctagtctctctgactgtgagcctggtcatcgtcaccaccctggtgtggcac
ctcctcaaggcacccccagagccacctgccccactgcccccagaggacaggcgtcaatca
gtgagccggcagccttccttcacctactcagagtggatggaggagaaggtagaggatgac
ttcctggacctggacgcggtgcccgagacacctgtgtttgactgtgtgatggacatcaag
cctgagactgatcctgcctcattgactgtcaagtccatgggtctacaggagaggagagga
tccaatgtctccttgaccctggacatgtgtactcctggctgcaatgaggagggcttcggc
tacctggtgtctccacgagaagagtcagcccatgagtatctgctcagcgcctcccgtgtc
ctccgggcagaagagctacatgaaaaggctctggaccctttcttgctgcaggcggaattc
tttgaaatccccatgaactttgtggatccaaaagagtatgacatcccagggctggtgcgg
aagaatcggtacaaaaccatccttcccaatcctcacagcagggtacgtctgacgtcacca
gaccctgaagatcctctgagttcctacatcaatgccaactacatccggggctacagtggg
gaggagaaggtgtacatcgccacgcagggacccatcgtcagcactgtggccgacttttgg
cgcatggtgtggcaggagcgcacacccatcatcgtcatgatcaccaacatcgaggagatg
aacgagaagtgcacagaatactggccagaagagcaggtggtccatgacggcgtggagatc
accgtgcagaaagtcatccacacggaggactaccggctgcgactcatctccctcaggaga
gggactgaagagcgaagcttgaagcattactggttcacatcctggcctgaccagaagacc
cccgaccgggctcccccactcctgcacctggtacgggaagtggaggaggcagcccaacaa
gagggaccccattgttccccaatcatcgttcactgcagtgcagggattgggagaactggc
tgcttcattgccaccagcatctgctgccagcagctgcgacgtgagggcgtggtggacatc
ctgaagaccacgtgccagctccgtcaggacaggggtggcatgatccagacatgcgaacag
taccagtttgtgcaccacgccatgagcctctatgagaagcagctgtccctccagtcctca
gagtga

DBGET integrated database retrieval system