KEGG   Mus musculus (mouse): 19263Help
Entry
19263             CDS       T01002                                 

Gene name
Ptprb, 3230402H02Rik, C130094E24, Ptpz, Rptpb, VE-PTP, Veptp
Definition
(RefSeq) protein tyrosine phosphatase, receptor type, B (EC:3.1.3.48)
  KO
K05694  
receptor-type tyrosine-protein phosphatase beta [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
Adherens junction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Cellular commiunity
   04520 Adherens junction
    19263 (Ptprb)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19263 (Ptprb)
Protein phosphatases and associated proteins [BR:mmu01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    19263 (Ptprb)
Cell adhesion molecules and their ligands [BR:mmu04516]
 5. Cadherin Family
  Classic Cadherins
   Vertebrate Type II classic cadherins
    CDH5; cadherin 5, type 2, VE-cadherin [KO:K06533]
     19263 (Ptprb)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
10; 10 D2
AA seq 1998 aa AA seqDB search
MLRHGALTALWITLSVVQTGVAEQVKCNFTLLESRVSSLSASIQWRTFASPCNFSLIYSS
DTSGPMWCHPIRIDNFTYGCNPKDLQAGTVYNFRIVSLDGEESTLVLQTDPLPPARFEVN
REKTASTTLQVRWTPSSGKVSWYEVQLFDHNNQKIQEVQVQESTTWSQYTFLNLTEGNSY
KVAITAVSGEKRSFPVYINGSTVPSPVKDLGISPNPNSLLISWSRGSGNVEQYRLVLMDK
GAIVQDTNVDRRDTSYAFHELTPGHLYNLTIVTMASGLQNSRWKLVRTAPMEVSNLKVTN
DGRLTSLNVKWQKPPGDVDSYSITLSHQGTIKESKTLAPPVTETQFKDLVPGRLYQVTIS
CISGELSAEKSAAGRTVPEKVRNLVSYNEIWMKSFTVNWTPPAGDWEHYRIVLFNESLVL
LNTTVGKEETHYALDGLELIPGRQYEIEVIVESGNLRNSERCQGRTVPLAVLQLRVKHAN
ETSLGITWRAPLGEWEKYIISLMDRELLVIHKSLSKDAKEFTFTDLMPGRNYKATVTSMS
GDLKQSSSIKGRTVPAQVTDLHVNNQGMTSSLFTNWTKALGDVEFYQVLLIHENVVVKNE
SVSSDTSRYSFRALKPGSLYSVVVTTVSGGISSRQVVAEGRTVPSSVSGVTVNNSGRNDY
LSVSWLPAPGEVDHYVVSLSHEGKVDQFLIIAKSVSECSFSSLTPGRLYNVTVTTKSGNY
ASHSFTEERTVPDKVQGISVSNSARSDYLKVSWVHATGDFDHYEVTIKNRESFIQTKTIP
KSENECEFIELVPGRLYSVTVSTKSGQYEASEQGTGRTIPEPVKDLTLLNRSTEDLHVTW
SRANGDVDQYEVQLLFNDMKVFPHIHLVNTATEYKFTALTPGRHYKILVLTISGDVQQSA
FIEGLTVPSTVKNIHISANGATDRLMVTWSPGGGDVDSYVVSAFRQDEKVDSQTIPKHAS
EHTFHRLEAGAKYRIAIVSVSGSLRNQIDALGQTVPASVQGVVAANAYSSNSLTVSWQKA
LGVAERYDILLLNENGLLLSNVSEPATARQHKFEDLTPGKKYKMQILTVSGGLFSKESQA
EGRTVPAAVTNLRITENSSRYLSFGWTASEGELSWYNIFLYNPDRTLQERAQVDPLVQSF
SFQNLLQGRMYKMVIVTHSGELSNESFIFGRTVPAAVNHLKGSHRNTTDSLWFSWSPASG
DFDFYELILYNPNGTKKENWKEKDVTEWRFQGLVPGRKYTLYVVTHSGDLSNKVTGEGRT
APSPPSLLSFADVANTSLAITWKGPPDWTDYNDFELQWFPGDALTIFNPYSSRKSEGRIV
YGLHPGRSYQFSVKTVSGDSWKTYSKPISGSVRTKPDKIQNLHCRPQNSTAIACSWIPPD
SDFDGYSIECRKMDTQEIEFSRKLEKEKSLLNIMMLVPHKRYLVSIKVQSAGMTSEVVED
STITMIDRPPQPPPHIRVNEKDVLISKSSINFTVNCSWFSDTNGAVKYFAVVVREADSMD
ELKPEQQHPLPSYLEYRHNASIRVYQTNYFASKCAESPDSSSKSFNIKLGAEMDSLGGKC
DPSQQKFCDGPLKPHTAYRISIRAFTQLFDEDLKEFTKPLYSDTFFSMPITTESEPLFGV
IEGVSAGLFLIGMLVALVAFFICRQKASHSRERPSARLSIRRDRPLSVHLNLGQKGNRKT
SCPIKINQFEGHFMKLQADSNYLLSKEYEDLKDVGRSQSCDIALLPENRGKNRYNNILPY
DASRVKLCNVDDDPCSDYINASYIPGNNFRREYIATQGPLPGTKDDFWKMAWEQNVHNIV
MVTQCVEKGRVKCDHYWPADQDPLYYGDLILQMVSESVLPEWTIREFKICSEEQLDAHRL
IRHFHYTVWPDHGVPETTQSLIQFVRTVRDYINRSPGAGPTVVHCSAGVGRTGTFVALDR
ILQQLDSKDSVDIYGAVHDLRLHRVHMVQTECQYVYLHQCVRDVLRAKKLRNEQENPLFP
IYENVNPEYHRDAIYSRH
NT seq 5997 nt NT seq  +upstreamnt  +downstreamnt
atgctgaggcatggagccctaacggccttgtggataacactgagcgtcgtgcagactgga
gtggcagagcaagtgaaatgtaacttcacactgttggagtccagggtctctagcttgtca
gcgtctatccagtggaggactttcgcgtcaccctgtaactttagcctcatctacagcagt
gatacctcggggcccatgtggtgccatcctattcggatagacaactttacctacggatgt
aaccccaaggatttacaagcagggaccgtctataacttcaggattgtttctctggatgga
gaagagagcactctggtcttacagacagatccgttgcctcctgccaggtttgaagtcaat
cgggagaaaacagcatcaaccaccctgcaggtccggtggactccctcttctggaaaagtc
tcctggtatgaggtgcaattatttgatcataacaatcaaaagatacaagaagtccaagtt
caagaaagtaccacctggagccaatatacttttctgaacctcactgagggtaacagttac
aaagttgccatcacagctgtttcgggagaaaagcgctcctttccggtgtatatcaatggc
tctacagtaccatctccagtgaaagatcttggcatttcccccaatcctaattctctccta
atttcctggtctcgtggttctgggaatgtggaacaatacaggctggtgctaatggataaa
ggggccatcgttcaagacacaaacgtggacaggcgtgatacttcttatgcttttcacgag
ctgacccctggccacctctacaacctcactattgtcaccatggcctcgggactgcaaaac
tccaggtggaaactggtgaggaccgctcccatggaagtctcaaatctgaaggtgacaaat
gacgggaggttgacctctctaaatgtgaagtggcagaaaccccctggggatgtagattcc
tacagcattaccctgtctcaccaagggaccatcaaagaatccaaaacattagcacctcct
gttactgaaactcaatttaaggacttagtccctggacggctttaccaagtgaccatcagc
tgcatctctggtgagctctctgctgagaagtcagcagcggggagaacagttccagaaaaa
gtgaggaatctggtttcctacaacgagatttggatgaagtcctttacagtgaactggacg
ccccctgctggagattgggagcattatcgtatcgtgctcttcaatgaatccttggtcttg
ctcaacaccacagtgggaaaggaagaaacgcactatgccttggatggcttggagctcata
ccaggaagacagtatgagatagaagtcattgttgagagcggaaatctgcggaattccgag
cgctgtcaaggcaggacagtacccctggctgtcctccagcttcgcgtcaaacacgctaac
gaaacttcactgggcatcacgtggcgggcccctctaggcgaatgggagaaatacatcatt
tcgttgatggacagagagctcttggtcatccacaagtcactctccaaagatgccaaagaa
ttcacttttacagacctgatgcctggacggaattacaaggctactgtcactagcatgagt
ggagatttaaaacagtcatcttcaatcaaaggaagaacagtgcctgcccaggtgactgac
ctgcacgtcaacaaccaagggatgaccagtagtctgttcactaactggacaaaggcactg
ggagatgtagagttctaccaagttttactgatccatgaaaatgtggttgtcaagaacgag
agtgtttccagtgataccagcagatacagcttccgcgccctgaaacccggcagcctctac
tccgtggtggtgaccacggtgagtggagggatctcctcccggcaggtggtggcggaagga
agaacagtcccgtccagcgtgagtggggtgacagtcaacaattctggccggaatgactac
ctcagcgtttcctggctgccggcgcctggagaagtggatcactacgtggtgagcctctcc
cacgagggcaaggtggatcagttcctcatcatcgccaaatctgtcagcgagtgttccttc
agctccctcaccccgggccgcctctacaacgtcactgtaaccaccaagagcggcaattat
gcaagccactccttcaccgaggaacggacagtgccagacaaggtccagggaatcagtgtt
agcaactctgccagaagcgactacttaaaggtgtcctgggtgcatgccactggagacttt
gaccactatgaagtcaccatcaaaaacagagaaagcttcattcaaaccaaaaccatcccc
aagtcagaaaatgagtgtgaatttattgagctggttcctggacgcctgtacagcgtcact
gtcagtacaaagagtggacaatatgaagccagtgaacaggggacagggagaacgatccca
gagcctgtgaaggatctcacccttctcaacaggagtacggaggatctccatgtgacttgg
tcaagagccaatggggatgttgatcagtacgaggtccagctgctcttcaacgacatgaaa
gtcttccctcatattcaccttgtgaacacagcaactgagtataagttcacggcgctcacg
ccggggcgccattacaaaatcctcgtcctgaccatcagtggcgatgtccagcagtcagcc
ttcattgaaggcctcacagttcccagcactgtcaaaaacattcacatttctgccaatgga
gccacggataggctgatggtaacctggagccctggtggcggggatgtggactcctatgtg
gtgtctgcattcagacaggacgagaaggttgactctcagaccattcccaagcatgcctcg
gagcacacgttccacaggctggaggccggagccaagtacaggatcgccattgtttctgtc
agtgggtccctgagaaaccagatagatgcgctcggacagacagtcccagcgtctgtccag
ggagtcgtcgcagccaatgcatacagcagtaattccttaacagtaagttggcagaaagcc
cttggtgtggcagaaagatacgatatcctgcttctaaacgagaatgggcttcttttgagc
aacgtgtcagagccagctacggcaagacagcacaaatttgaagatctaacgccaggcaag
aaatacaagatgcagatcctgactgtcagcggaggcctcttcagtaaagaatctcaggct
gaaggccgaacagtcccagcagctgtcaccaatctgaggatcacagagaactccagtaga
tacctgtccttcggctggaccgcctcggagggtgaactcagctggtacaacatcttcctc
tacaacccagacaggactcttcaggagcgagctcaagttgacccgctagtccagagcttc
tctttccagaacttgctacaaggcagaatgtacaagatggtgattgtcactcacagtggg
gagctgtccaatgagtcatttatattcggcagaacagttcctgctgccgtgaaccatctc
aaaggctcccatcggaacacgacagacagcctgtggttcagctggagcccagcctccggg
gactttgacttctatgagctgattctttacaatcccaacggcacgaagaaggagaactgg
aaagaaaaggacgtgacagagtggcgtttccaaggtcttgttcctggaaggaaatacacc
ctgtatgtggtgactcacagtggggacctcagcaataaagtcacaggggagggcagaaca
gccccaagtcctccgagtcttttgtcattcgctgatgttgcaaacacctccttggctatc
acctggaagggacccccagactggacagattacaatgactttgagctgcagtggttccct
ggagatgcacttaccatcttcaacccctacagcagcagaaagtcagaaggacgcattgtg
tacgggcttcacccagggaggtcctatcaattcagtgtcaagactgtgagcggggactcc
tggaaaacctacagcaaaccaatttctgggtctgtgaggacaaagccagacaagatacaa
aacctgcattgccgcccccagaactccacggccattgcctgctcttggatacctcctgac
tccgactttgatggctacagcattgagtgccgaaaaatggatacccaagaaatcgagttt
tccagaaagctggagaaagaaaaatcactgctcaacatcatgatgttagtacctcataag
aggtacctggtgtccatcaaggtgcagtcggccggcatgaccagtgaggtggttgaagat
agcaccatcaccatgatagaccgcccgcctcaaccgcctccacacatccgtgtgaatgaa
aaggatgtgctaatcagcaaatcttccatcaactttactgtcaactgcagctggttcagc
gacaccaacggagcggttaaatactttgctgtggtggtgagagaggccgacagcatggat
gagttgaagccagaacagcagcaccctctcccttcctacctggagtacagacacaacgcc
tccatccgagtctaccagaccaattattttgccagcaaatgtgctgaaagtcccgacagc
agttctaaaagtttcaacattaagcttggagcagagatggacagcctcggtggcaaatgt
gatcccagtcagcagaaattctgtgatggaccgctgaagccacacaccgcctacagaatc
agcatccgggcttttacacagctatttgacgaggacttgaaagagttcaccaaacctctc
tactcggatacgttcttctctatgcccatcaccacagagtcagagcccttgtttggagtt
attgaaggtgtgagtgctggcctgtttctaattggcatgctggtggcccttgttgccttc
ttcatctgcagacagaaagctagccacagcagggaaaggccatctgcccggctcagcatt
cgtagggaccggcctttgtctgtccatctgaatctgggccagaaaggcaaccggaaaact
tcttgccccataaagatcaatcagtttgaagggcatttcatgaagctgcaggcagactcc
aactaccttctatccaaggaatatgaggacttaaaagacgtgggtagaagccagtcatgt
gacattgccctcttgcctgagaatcgagggaaaaatcgatacaacaacatattgccttat
gatgcctcaagagtgaagctctgcaatgtcgatgacgacccttgctctgactacatcaac
gccagctacatccccggtaacaacttcagacgagaatacatcgccactcagggaccgctt
ccaggcaccaaggatgacttctggaagatggcgtgggagcagaacgttcacaacatcgtc
atggtgacccagtgtgttgaaaagggccgagtgaagtgtgaccattactggccagcagac
caggaccccctctactacggtgatctcatcctacagatggtctcggagtccgtgctcccc
gagtggaccatcagggagtttaagatatgcagtgaagaacagttggatgcacacagactc
atccgtcactttcactacacggtgtggccagaccatggggtcccagagaccacccagtcc
ctgatccaatttgtgaggacagtcagggactacatcaacagaagccccggggctgggccc
accgtagtgcactgcagcgctggtgtgggcagaacagggacgttcgttgccctggaccgg
atcctccagcagttggactctaaggactccgtggacatttatggggcagtgcatgaccta
agactccacagggttcacatggtccagaccgagtgtcaatatgtgtatctgcatcagtgt
gtaagagacgtcctcagagcaaagaaactgcggaacgagcaagagaaccccctgtttccg
atttatgagaatgtgaatccagagtatcacagagatgcaatctactcgagacattaa

DBGET integrated database retrieval system