KEGG   Mus musculus (mouse): 192654Help
Entry
192654            CDS       T01002                                 

Gene name
Pla2g15, ACS, C87498, LLPL, Lpla2, Lypla3
Definition
phospholipase A2, group XV (EC:2.3.1.-)
Orthology
K06129  
lysophospholipase III [EC:3.1.1.5]
Organism
mmu  Mus musculus (mouse)
Pathway
Glycerophospholipid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    192654 (Pla2g15)
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    192654 (Pla2g15)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     192654 (Pla2g15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
8 D3; 8
AA seq 412 aa AA seqDB search
MDRHLCTCRETQLRSGLLLPLFLLMMLADLTLPAQRHPPVVLVPGDLGNQLEAKLDKPKV
VHYLCSKKTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGE
TFSMEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREM
IEEMYQMYGGPVVLVAHSMGNVYMLYFLQRQPQVWKDKYIHAFVSLGAPWGGVAKTLRVL
ASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTTNYTLRDYHRFFR
DIGFEDGWFMRQDTEGLVEAMTPPGVELHCLYGTGVPTPNSFYYESFPDRDPKICFGDGD
GTVNLESVLQCQAWQSRQEHRVSLQELPGSEHIEMLANATTLAYLKRVLLEP
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atggatcgccatctctgcacctgtcgcgagacccagctccggagtggcctcctgttacct
ctgtttctactaatgatgctggcagacctgacgctcccggcccaacgtcaccccccggtg
gtgctggtgcctggtgatttgggtaaccagttggaagcaaagctggataagccaaaggtt
gtacactacctttgctccaagaagacggacagctacttcacactctggctgaatctggaa
ctgcttctgcctgttatcattgactgctggattgacaatatcaggctggtttacaacaga
acatctcgggccacccagtttcccgatggtgtggacgtgcgtgtccctggctttggggaa
acattttctatggaattcctagaccccagcaagaggaatgtgggttcctatttctacact
atggtggagagccttgtgggctggggctacacacggggtgaagacgttcgaggtgctccc
tatgattggcggcgagccccaaatgaaaacgggccctacttcttggccctgcgagagatg
atcgaggagatgtaccagatgtatgggggccccgtggtgctggtcgcccacagcatgggc
aacgtgtacatgctctactttctgcagcggcagccacaagtctggaaggacaaatatatc
catgccttcgtctcactgggggcgccctgggggggcgtggccaagacgctgcgtgtcctg
gcctcaggagacaacaatcgcattcccgtcattgggccactgaagatccgggaacagcag
cgatctgccgtctctaccagctggctactgccatacaaccacacttggtcacatgaaaag
gtatttgtatacacacccacgactaactacacgctccgggactatcaccggttcttccgg
gacatcggtttcgaagatggctggttcatgcggcaggacacagaagggctggttgaagcc
atgacgccacccggggtggagctgcactgcttgtatggcactggtgttcccacgccaaac
tctttctactacgagagctttcctgatcgggaccccaaaatctgcttcggcgatggtgac
ggcacggtgaacctggagagcgtcctgcagtgccaagcctggcagagccgccaagagcac
agagtatcattgcaggagctgccgggaagcgagcacattgagatgctagccaatgccacc
accttggcttatctgaaacgtgtgcttctggaaccttga

DBGET integrated database retrieval system