KEGG   Mus musculus (mouse): 192656Help
Entry
192656            CDS       T01002                                 

Gene name
Ripk2, 2210420D18Rik, CARD3, CARDIAK, CCK, D4Bwg0615e, RICK, RIP2
Definition
(RefSeq) receptor (TNFRSF)-interacting serine-threonine kinase 2 (EC:2.7.11.1 2.7.10.2)
  KO
K08846  
receptor-interacting serine/threonine-protein kinase 2 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
NOD-like receptor signaling pathway
Neurotrophin signaling pathway
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04621 NOD-like receptor signaling pathway
    192656 (Ripk2)
  Nervous system
   04722 Neurotrophin signaling pathway
    192656 (Ripk2)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    192656 (Ripk2)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     192656 (Ripk2)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: TKL group
  RIPK family [OT]
   192656 (Ripk2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
4 A2; 4 6.7 cM
AA seq 539 aa AA seqDB search
MNGDAICSALPPIPYHKLADLHYLSRGASGTVSSARHADWRVRVAVKHLHIHTPLLDSER
NDILREAEILHKARFSYILPILGICNEPEFLGIVTEYMPNGSLNELLHRKTEYPDIAWPL
RFRILHEIALGVNYLHNMNPPLLHHDLKTQNILLDNEFHVKIADFGLSKWRMMSLSQSRS
YKSAPEGGTIIYMPPENYEPGQKSRASVKHDIYSYAVIMWEVLSRKQPFEEVTNPLQIMY
SVSQGHRPDTSEENLPFDIPHRGLMISLIQSGWAQNPDERPSFLKCLIELEPVLRTFEDI
TFLEAVIQLKKAKIQSSSSTIHLCDKKMDLSLNIPANHPPQEESCGSSLLSRNTGSPGPS
RSLSAPQDKGFLSGAPQDCSSLKAHHCPGNHSWDGIVSVPPGAAFCDRRASSCSLAVISP
FLVEKGSERPPIGIAQQWIQSKREAIVSQMTEACLNQSLDALLSRDLIMKEDYELISTKP
TRTSKVRQLLDTSDIQGEEFAKVVVQKLKDNKQLGLQPYPEVPVLSKAPPSNFPQNKSL
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atgaacggggacgccatctgcagcgcgctaccccccatcccgtaccacaagctcgccgac
ctgcactacctcagccggggcgcctctggcacggtctcgtcggcacgacacgcagactgg
cgcgtgcgggtggcagtgaagcacctacacatccacacgccgctgctcgacagtgaaaga
aatgatatcttacgagaagccgaaatattacataaagcaagatttagttacattcttcca
attttgggaatttgcaatgagcctgaatttttgggcatagttactgaatacatgccaaat
ggatcattaaatgagcttctacacagaaaaactgaatatcctgatattgcatggccattg
agattccgcatcctgcatgaaattgctcttggtgtaaattatctgcacaatatgaacccc
cctctgcttcatcatgacctaaagactcagaatatcttgttggataatgaatttcatgtt
aagattgcagattttggtttatcaaaatggcgcatgatgtcactctctcaatcacgaagt
tacaaatctgcacccgaaggaggaacaatcatctatatgccacctgagaactatgagcca
ggacagaaatcaagggccagtgtgaagcatgatatatacagctatgcagttatcatgtgg
gaagtgttatccagaaaacagccttttgaagaggtcaccaatcctttgcagatcatgtac
agtgtgtcccagggacatcgacctgacaccagtgaggagaatttgccatttgatatacct
catcgaggtctcatgatctctctaatacagagtggatgggcgcaaaacccagatgaaaga
ccatcctttttgaaatgcttaatagaacttgaaccagttctgagaacatttgaagacata
actttccttgaggctgttattcagctaaagaaagcaaagatacagagttcctcaagtact
attcacttatgtgataagaaaatggatttatcgctaaacatacctgcaaatcatccccca
caggaggaatcgtgtggatcctctctgctctctagaaacactggttctcctggaccctcc
agatccctatcagctcctcaagacaagggatttttatctggagcacctcaagactgctct
tcgttgaaggcacaccactgtcctggaaaccacagctgggatggtatcgtttctgtacca
ccaggggcagccttctgtgatcgcagggcctcctcgtgttccttggctgtaataagtcca
ttcttggttgagaaaggttcagagcgcccaccaattggtatagcccaacagtggatccag
agtaagagggaagccattgtgagccagatgactgaagcctgccttaaccaatcgctggac
gcccttctgtctcgtgacctgatcatgaaggaggactatgaactcattagcaccaaacct
acaaggacctcaaaagtcagacagctgctagatacgtctgacatccaaggagaagagttt
gccaaagttgtagtgcagaagttgaaagataacaagcagctggggctgcagccttaccca
gaagtacctgtgctttccaaagcaccgccttcaaatttccctcagaataaaagcttgtaa

DBGET integrated database retrieval system