KEGG   Mus musculus (mouse): 192775Help
Entry
192775            CDS       T01002                                 

Gene name
Kcnh6, m-erg2
Definition
(RefSeq) potassium voltage-gated channel, subfamily H (eag-related), member 6
  KO
K04909  
potassium voltage-gated channel Eag-related subfamily H member 6
Organism
mmu  Mus musculus (mouse)
Brite
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  K+ channel, KCNH, Kv10-12.x (Ether-a-go-go)
   192775 (Kcnh6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11; 11 E1
AA seq 950 aa AA seqDB search
MPVRRGHVAPQNTYLDTIIRKFEGQSRKFLIANAQMENCAIIYCNDGFCELFGYSRVEVM
QRPCTCDFLTGPNTPSSAVSRLAQALLGAEECKVDILYYRKDASSFRCLVDVVPVKNEDG
AVIMFILNFEDLAQLLAKSSSRSLTQRLLSHSFLGSEGSHSRPSGQGPGPGRGKYGTVSQ
IPQFTLSFVEFNLEKHRSGSTTEIEIIAPHKVVERTQNVTEKVTQVLSLGADVLPEYKLQ
APRIHRGTILHYSPFKAVWDWLILLLVIYTAVFTPYSAAFLLSDQDDSQRGTCGYTCSPL
TVVDLIVDIMFVVDIVINFRTTYVNTNDEVVSHPRRIAVHYFKGWFLIDMVAAIPFDLLI
FRTGSDETTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLFLLMCTFALIAHWLACIWY
AIGNVERPYLEPKIGWLDSLGAQLGKHYNGSDPASGPSVQDKYVTALYFTFSSLTSVGFG
NVSPNTNSEKVFSICVMLIGSLMYASIFGNVSAIIQRLYSGTARYHTQMLRVKEFIRFHQ
IPNPLRQRLEEYFQHAWSYTNGIDMNAVLKGFPECLQADICLHLHRALLQHCPAFRGASK
GCLRALAVKFKTTHAPPGDTLVHLGDVLSTLYFISRGSIEILRDDVVVAILGKNDIFGEP
ASLHARPGKSSADVRALTYCDLHKIHRADLLEVLDMYPAFADTFWNKLEVTFNLRDADGG
LHSTPRQAPGNQDPQGFFLNDSQSGAAPSLSISDTSGLWPELLQQMPPSPPNPREKLDCW
PRELGFKLEQLQAQMNRLESRVSSDLSRILQLLQHPQGHPGYILGAPASSDLALFPETSV
TQSSESMLLVGHLPSAQTLSYGDLDKHIRMPRNFSPRIPHVAAAMDKSLVPSSEQEQPKG
LLSPLASPLCPLEVQGLGGPHFSSLPEHLSSVPKQLEFQRHGSDPGFTRS
NT seq 2853 nt NT seq  +upstreamnt  +downstreamnt
atgccagtccgcaggggccacgttgctccccaaaacacttacttggacaccatcatccgc
aagtttgagggccagagtcgtaagttcctgattgccaatgcacagatggagaactgtgcc
atcatctactgcaatgatggcttctgcgaactcttcggctactcccgtgtggaggtgatg
cagcgaccctgtacctgtgacttcctcactggcccgaacactccgagcagtgctgtgtcc
cgcctggcgcaggccctgcttggggctgaagagtgcaaggtggacatcctctactatcgc
aaggatgcctccagcttccgctgcctggtggatgtggtccctgtgaagaacgaggatggg
gctgtcatcatgttcatcctcaatttcgaggacctggcccagctcctggccaagagcagc
agccgcagcctgacccaacgtttgttgtcacacagcttcctgggctctgagggctctcac
agcaggccaagcggacaggggcctggtccaggcaggggcaagtatggaactgtcagccag
atcccgcagttcacgctcagctttgtggagttcaacctggagaagcaccgctcaggctcc
accacagagattgagatcatcgctccccacaaggtggtggagcggacacagaatgtcact
gaaaaggtcacgcaggtcctgtccctgggtgcagatgtgctgccagagtacaagctgcag
gcaccgcgcattcaccgaggtaccattctgcactacagccccttcaaggctgtatgggac
tggctcatcttgctcttagtcatctatacagcggtcttcacgccctactctgctgccttt
ctgcttagcgaccaggacgactcacagcgtggtacctgcggctatacctgcagcccgctc
accgtggtggacctcatcgtggatatcatgtttgtggtggatattgtcatcaacttccga
accacctacgtcaacactaatgacgaggtggtcagccacccccgacgaatcgccgtccac
tatttcaagggctggttcctcattgacatggtggctgccatcccttttgacttgcttatc
ttccgcactggctcagatgagaccaccaccctgatcgggttactgaagacggcgcgcctc
ctacggctggtgcgcgtggcccggaagctggaccgctattctgaatacggggccgccgta
ctcttcctgctcatgtgtacttttgcgctcattgcgcactggctggcctgtatctggtac
gccatcggcaatgtggagcgaccctacttggagcccaagattggttggctggacagcctg
ggcgcgcagcttggcaagcactataacggcagcgacccagcctcgggaccctctgtccaa
gacaagtatgtcaccgccctctacttcaccttcagcagcctcactagtgtgggcttcggc
aatgtgtcacccaacaccaactctgagaaggtcttctctatctgcgtcatgctcattggc
tcacttatgtacgccagcatctttggcaacgtgtcggccatcatccagcgcctgtactca
ggcacggctcgctaccacactcagatgctgcgggtcaaggagttcatccgcttccaccag
atccccaacccactgaggcagcgcctggaagagtatttccagcacgcctggtcctacacc
aatggcatcgacatgaacgcggtgctgaaaggcttccctgagtgcctgcaggcggacatc
tgcctgcacctgcaccgcgctctgttgcagcactgccccgccttccgcggcgccagcaag
gggtgcctgcgcgcgctcgccgtcaagttcaagaccacgcacgcgccgcctggggacacg
ctggtgcacctgggcgacgtgctttccactctctacttcatctcccgcggctccatcgag
atcctgcgcgatgacgtggtcgtggccattctagggaagaatgacatctttggggagcct
gccagtctccatgccagaccaggcaaatcaagcgccgatgtgcgtgccctgacctactgc
gacctgcacaagatccatcgagcagacctgctggaggtgctggacatgtaccccgccttt
gcagataccttctggaataagctagaggtcaccttcaacctgcgggacgcagatgggggt
ctccactcaacaccccgacaggccccaggcaaccaagacccccaaggcttcttcctcaat
gacagccaatcaggtgctgccccttccctgagcatttcagacacatctgggctttggcct
gaattgctacagcaaatgcccccaagtcccccaaacccacgagagaagctggattgctgg
cctcgggagctaggctttaagttagaacagctccaagcccagatgaacagactggagtcc
cgcgtgtcgtcagacctcagccgcatcctacagctacttcagcatccacagggccacccc
ggctacatcttgggggcccctgcctccagtgacctggccttgtttcctgaaacttcagtg
actcagagttcagagtcgatgcttctggtgggacatctgccctctgcacagaccctaagc
tatggtgatttggacaaacatatccggatgcccaggaatttctcccccaggatacctcac
gtggccgcggcaatggacaaatctctggtgccgtcctcagaacaagagcagcccaagggg
ctcctgtcacctctggcctcacctctgtgtcccctggaagtacagggactgggtggtccc
cacttttcctccctccctgaacacctcagctccgttcccaagcagctggaattccagaga
cacggttcagatcctggattcacaaggagttag

DBGET integrated database retrieval system