KEGG   Mus musculus (mouse): 19279Help
Entry
19279             CDS       T01002                                 

Gene name
Ptprr, Gmcp1, PTP-SL, PTPBR7, RPTPRR, mPTP213
Definition
protein tyrosine phosphatase, receptor type, R (EC:3.1.3.48)
Orthology
K04458  
receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04010 MAPK signaling pathway
    19279 (Ptprr)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     19279 (Ptprr)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
10; 10 A2
AA seq 549 aa AA seqDB search
MHRNTRSVSTPTLQMDITKLNITLLRIFRQGVAAALGLLPQQVHINRLIEKKNQVELFVS
PGNRKPGETQALQAEEVLRSLNVDGLHQSLPQFGITDVAPEKNVLQGQHEADKIWSKEGF
YAVVIFLSIFIIIVTCLMIIYRLKERLQLSLRQDKEKNQEIHLSPIARQQAQSEAKTTHS
MVQPDQAPKVLNVVVDPQGQCTPEIRNSTSTSVCPSPFRMKPIGLQERRGSNVSLTLDMS
SLGSVEPFVAVSTPREKVAMEYLQSASRVLTRSQLRDVVASSHLLQSEFMEIPMNFVDPK
EIDIPRHGTKNRYKTILPNPLSRVCLRPKNITDSLSTYINANYIRGYSGKEKAFIATQGP
MINTVNDFWQMVWQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVTGVTECDNY
TIRNLVLKQGSHTQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASEGRGPVVVHC
SAGIGRTGCFIATSIGCQQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLFE
SRLSPETVE
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgcatcgcaacactcggtcagtttccacaccgacactgcaaatggatataaccaagctg
aacataaccctgcttcggatcttccgccaaggagtagctgcagccctgggactcttacct
cagcaagtgcacattaaccggctcattgaaaagaagaaccaggttgagttgtttgtgtct
cccggaaaccggaaaccaggagaaacgcaggccctgcaggctgaggaagtgctgcgttcc
ctcaatgtggatggtttgcatcagagtttaccacagtttggaattacagacgtcgcccct
gagaaaaatgttttacaagggcagcacgaagcagacaagatctggagcaaagaaggattt
tacgctgtcgtcatcttcctcagcatctttatcatcatagtaacctgtttgatgattatt
tacaggttaaaagaaaggcttcagctttccttaagacaagataaagagaaaaaccaggag
atccacctatcacccattgcacggcagcaagcacaatcggaggccaagacgacccacagc
atggtccagcccgatcaggcgccaaaggtgctgaacgtggttgtggaccctcaaggccaa
tgcactcctgagattcgaaacagcacctccacctctgtctgcccttctcccttcagaatg
aagcccataggactccaggagcgacgaggttccaatgtatctcttacgctggacatgagt
agcctgggcagtgtggaaccctttgtggccgtctcaaccccccgggagaaggtagccatg
gaatacctgcagtcagccagccgagttctcacacggtcacagctgagggacgtcgtggca
agttcccacctacttcaaagtgaattcatggaaataccaatgaattttgtggatcccaaa
gaaattgatattccacgtcacggaactaaaaatcgttataagaccattttgccaaatccc
ctcagcagagtgtgcttaagaccaaaaaatataaccgattccttgagtacttacataaat
gctaactatattcggggctacagtggtaaggagaaagccttcattgccacccagggcccc
atgatcaacactgtgaatgacttctggcagatggtgtggcaagaagacagtcccgtgatt
gtgatgatcacgaaactcaaagagaaaaatgagaaatgtgtgctctactggccagaaaag
agagggatttacggcaaggttgaggttctggtcaccggtgtgaccgaatgtgataactac
accatccgcaacctcgtcttaaagcaaggaagtcacacccaacatgtgaagcactactgg
tacacttcatggccggatcataagactccagacagtgcccagccccttctgcagctcatg
ttggatgtggaagaagacagactggcctctgaaggccgagggcctgtggttgtccactgc
agtgcggggattgggagaactgggtgtttcatcgctacatccattggctgtcaacaattg
aaagaagaaggagttgtagacgcactaagtattgtctgccagcttcgtgtagacaggggt
ggtatggtccaaaccagcgagcagtatgaatttgtgcaccatgctctgtgcctgttcgag
agcagactttcaccagaaactgtcgagtga

DBGET integrated database retrieval system