KEGG   Mus musculus (mouse): 193034Help
Entry
193034            CDS       T01002                                 

Gene name
Trpv1, OTRPC1, TRPV1alpha, TRPV1beta, VR-1, Vr1
Definition
(RefSeq) transient receptor potential cation channel, subfamily V, member 1
  KO
K05222  
transient receptor potential cation channel subfamily V member 1
Organism
mmu  Mus musculus (mouse)
Pathway
Neuroactive ligand-receptor interaction
Inflammatory mediator regulation of TRP channels
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    193034 (Trpv1)
 Organismal Systems
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    193034 (Trpv1)
Ion channels [BR:mmu04040]
 Related to voltage-gated cation channels
  Transient receptor potential family, TRPV (Vanilloid)
   193034 (Trpv1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
11 45.25 cM; 11 B3
AA seq 839 aa AA seqDB search
MEKWASLDSDESEPPAQENSCPDPPDRDPNSKPPPAKPHIFATRSRTRLFGKGDSEEASP
MDCPYEEGGLASCPIITVSSVVTLQRSVDGPTCLRQTSQDSVSTGVETPPRLYDRRSIFD
AVAQSNCQELESLLSFLQKSKKRLTDSEFKDPETGKTCLLKAMLNLHNGQNDTIALLLDI
ARKTDSLKQFVNASYTDSYYKGQTALHIAIERRNMALVTLLVENGADVQAAANGDFFKKT
KGRPGFYFGELPLSLAACTNQLAIVKFLLQNSWQPADISARDSVGNTVLHALVEVADNTA
DNTKFVTNMYNEILILGAKLHPTLKLEELTNKKGLTPLALAASSGKIGVLAYILQREIHE
PECRHLSRKFTEWAYGPVHSSLYDLSCIDTCEKNSVLEVIAYSSSETPNRHDMLLVEPLN
RLLQDKWDRFVKRIFYFNFFVYCLYMIIFTTAAYYRPVEGLPPYKLNNTVGDYFRVTGEI
LSVSGGVYFFFRGIQYFLQRRPSLKSLFVDSYSEILFFVQSLFMLVSVVLYFSHRKEYVA
SMVFSLAMGWTNMLYYTRGFQQMGIYAVMIEKMILRDLCRFMFVYLVFLFGFSTAVVTLI
EDGKNNSLPVESPPHKCRGSACRPGNSYNSLYSTCLELFKFTIGMGDLEFTENYDFKAVF
IILLLAYVILTYILLLNMLIALMGETVNKIAQESKNIWKLQRAITILDTEKSFLKCMRKA
FRSGKLLQVGFTPDGKDDFRWCFRVDEVNWTTWNTNVGIINEDPGNCEGVKRTLSFSLRS
GRVSGRNWKNFALVPLLRDASTRDRHSTQPEEVQLKHYTGSLKPEDAEVFKDSMAPGEK
NT seq 2520 nt NT seq  +upstreamnt  +downstreamnt
atggagaaatgggctagcttagactcggatgaatctgagcccccagcccaagagaactcc
tgcccggaccctccagacagagaccctaactccaagccgcctccagccaagccccacatc
tttgctaccaggagtcgcacccggctttttgggaagggtgactcagaagaggcctctccc
atggactgcccttatgaggaaggcgggctggcctcctgccctatcatcaccgtcagctct
gttgtcactctccagaggtctgtggatggacctacctgtctcaggcagacatcccaggac
tctgtctccactggtgttgagacgcccccaaggctctatgatcgcaggagcatcttcgac
gctgtggctcagagcaactgccaggagctggagagcctgctgtccttcctgcagaagagc
aagaagcgcctgactgacagcgagttcaaagacccagagacgggaaagacctgtctgctc
aaagccatgctcaatctgcacaatgggcagaacgacaccattgctctgctcctggacatt
gcccggaagacagatagcctgaagcagtttgtcaatgccagctacacagacagctactac
aagggccagacagcattacacattgccattgaaaggcggaacatggcactggtgaccctc
ttggtggagaatggagcagatgtccaggctgctgctaacggggacttcttcaagaaaacc
aaagggaggcctggcttctactttggtgagctgcccctgtccctggctgcgtgcaccaac
cagctggccattgtgaagttcctgctgcagaactcctggcagcctgcagacatcagtgca
cgggattcggtgggcaacacggtgctgcacgcccttgtggaggtggcagataacacagct
gacaacaccaagttcgtgacaaacatgtacaacgagatcctgatcctgggggccaaactc
caccccacactgaagctagaagaactcaccaacaagaaggggcttacaccgctggctctg
gctgccagcagtgggaagattggggtcttggcctacattctccagagggagatccacgaa
ccagagtgccggcacctgtccaggaagttcactgaatgggcctatgggcccgtgcactcc
tccctttatgacctgtcctgcattgacacctgtgagaagaattcagtgctggaggtgatc
gcctacagtagcagtgagacccccaaccgccacgacatgcttctcgtggagcccttgaac
cgactcctgcaggacaagtgggacagatttgtcaagcgcatcttctacttcaacttcttc
gtctactgcttgtatatgatcatcttcaccacggctgcttactatcggcctgtggaaggc
ttgcccccctataagctgaataacaccgttggggactatttccgtgtcactggagagatc
ctgtctgtgtcaggaggagtctacttcttcttccgagggatccagtatttcctgcagagg
cgaccatccctcaagagtttgtttgtggacagctacagtgagatacttttctttgtacag
tcactgttcatgctggtgtctgtggtactgtacttcagccatcgcaaggagtatgtggct
tccatggtgttctccctggccatgggctggaccaacatgctctactacacccgaggattc
cagcagatgggcatctatgctgtcatgattgagaagatgatcctcagagacctgtgtcgg
tttatgttcgtctacctcgtgttcttgtttggattttccacagccgtagtgacactgatc
gaggatgggaagaataactcactgcctgtggagtccccaccacacaagtgtcggggatct
gcctgcaggccaggtaactcttacaacagcctgtattccacatgtctggagctgttcaag
ttcaccatcggcatgggtgacctggagttcaccgagaactatgacttcaaggctgtcttc
atcatcctgttactggcctatgtgattctcacctacatcctcctgctcaacatgctcatt
gctctcatgggcgagactgtcaacaagattgcacaagagagcaagaacatctggaagctg
cagcgagccatcaccatcctggatacagagaagagtttcctgaagtgcatgaggaaggcc
ttccgctccggcaagctgctgcaggtggggttcacgccggacggcaaggatgacttccgg
tggtgcttcagggtggatgaggtgaactggactacctggaacaccaacgtgggcatcatc
aacgaggacccaggcaactgtgagggcgtcaagcgcaccctgagcttctccctgcggtca
ggccgagtttcagggagaaactggaagaactttgccctggttccccttctgagggacgca
agcactcgagataggcatagcacccagccggaagaagttcagctgaagcactatacggga
tcccttaagccagaggatgctgaggtcttcaaggattccatggccccaggggagaaatga

DBGET integrated database retrieval system