KEGG   Mus musculus (mouse): 19349Help
Entry
19349             CDS       T01002                                 

Gene name
Rab7, Rab7a
Definition
(RefSeq) RAB7, member RAS oncogene family
  KO
K07897  
Ras-related protein Rab-7A
Organism
mmu  Mus musculus (mouse)
Pathway
Endocytosis
Phagosome
Salmonella infection
Amoebiasis
Tuberculosis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    19349 (Rab7)
   04145 Phagosome
    19349 (Rab7)
 Human Diseases
  Infectious diseases
   05132 Salmonella infection
    19349 (Rab7)
   05152 Tuberculosis
    19349 (Rab7)
   05146 Amoebiasis
    19349 (Rab7)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19349 (Rab7)
  Exosomal proteins of other body fluids (saliva and urine)
   19349 (Rab7)
  Exosomal proteins of colorectal cancer cells
   19349 (Rab7)
  Exosomal proteins of bladder cancer cells
   19349 (Rab7)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rab Family
   Rab7/9 [OT]
    19349 (Rab7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 D1; 6 39.13 cM
AA seq 207 aa AA seqDB search
MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ
IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF
VVLGNKIDLENRQVATKRAQAWCYSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV
ELYNEFPEPIKLDKNDRAKASAESCSC
NT seq 624 nt NT seq  +upstreamnt  +downstreamnt
atgacctctaggaagaaagtgttgctgaaggtcatcatcctgggggactctggtgttgga
aagacctctctcatgaaccagtatgtgaacaagaagttcagtaaccagtacaaagccaca
ataggagcggactttctgaccaaggaggtgatggtggacgacagacttgttaccatgcag
atctgggacacagccggtcaagaacggttccagtctcttggtgtggccttctacagaggt
gcagattgctgtgttctggtgtttgatgtgactgcccccaacactttcaaaaccctcgac
agctggagagacgagtttctcatccaggccagcccccgggatcccgagaacttccctttt
gttgtgttgggaaacaagattgacctggaaaacagacaagtggccacaaagagggcacag
gcttggtgctacagcaaaaacaacattccttacttcgagaccagtgccaaggaggccatc
aatgtggagcaggccttccagacaattgctcggaatgcccttaaacaggaaacagaagtg
gaactgtacaatgaattccctgaacccatcaaactggacaagaatgaccgggccaaggcc
tccgcagaaagctgcagttgttga

DBGET integrated database retrieval system