KEGG   Mus musculus (mouse): 19353Help
Entry
19353             CDS       T01002                                 

Gene name
Rac1, AL023026, D5Ertd559e
Definition
RAS-related C3 botulinum substrate 1
Orthology
K04392  
Ras-related C3 botulinum toxin substrate 1
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Phagosome
PI3K-Akt signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Toll-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Neurotrophin signaling pathway
Regulation of actin cytoskeleton
Non-alcoholic fatty liver disease (NAFLD)
Pancreatic secretion
Amyotrophic lateral sclerosis (ALS)
Bacterial invasion of epithelial cells
Salmonella infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    19353 (Rac1)
   04015 Rap1 signaling pathway
    19353 (Rac1)
   04010 MAPK signaling pathway
    19353 (Rac1)
   04310 Wnt signaling pathway
    19353 (Rac1)
   04370 VEGF signaling pathway
    19353 (Rac1)
   04024 cAMP signaling pathway
    19353 (Rac1)
   04151 PI3K-Akt signaling pathway
    19353 (Rac1)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    19353 (Rac1)
  Cell motility
   04810 Regulation of actin cytoskeleton
    19353 (Rac1)
  Cell communication
   04510 Focal adhesion
    19353 (Rac1)
   04520 Adherens junction
    19353 (Rac1)
 Organismal Systems
  Immune system
   04620 Toll-like receptor signaling pathway
    19353 (Rac1)
   04650 Natural killer cell mediated cytotoxicity
    19353 (Rac1)
   04662 B cell receptor signaling pathway
    19353 (Rac1)
   04664 Fc epsilon RI signaling pathway
    19353 (Rac1)
   04666 Fc gamma R-mediated phagocytosis
    19353 (Rac1)
   04670 Leukocyte transendothelial migration
    19353 (Rac1)
   04062 Chemokine signaling pathway
    19353 (Rac1)
  Digestive system
   04972 Pancreatic secretion
    19353 (Rac1)
  Nervous system
   04722 Neurotrophin signaling pathway
    19353 (Rac1)
  Development
   04360 Axon guidance
    19353 (Rac1)
   04380 Osteoclast differentiation
    19353 (Rac1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    19353 (Rac1)
   05205 Proteoglycans in cancer
    19353 (Rac1)
   05203 Viral carcinogenesis
    19353 (Rac1)
   05210 Colorectal cancer
    19353 (Rac1)
   05212 Pancreatic cancer
    19353 (Rac1)
   05211 Renal cell carcinoma
    19353 (Rac1)
  Neurodegenerative diseases
   05014 Amyotrophic lateral sclerosis (ALS)
    19353 (Rac1)
  Cardiovascular diseases
   05416 Viral myocarditis
    19353 (Rac1)
  Endocrine and metabolic diseases
   04932 Non-alcoholic fatty liver disease (NAFLD)
    19353 (Rac1)
  Infectious diseases
   05132 Salmonella infection
    19353 (Rac1)
   05100 Bacterial invasion of epithelial cells
    19353 (Rac1)
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   19353 (Rac1)
  Exosomal proteins of other body fluids (saliva and urine)
   19353 (Rac1)
  Exosomal proteins of colorectal cancer cells
   19353 (Rac1)
  Exosomal proteins of bladder cancer cells
   19353 (Rac1)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    19353 (Rac1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
5 G2; 5 82.22 cM
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLR
DDKDTIEKLKEKKLTPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPP
PVKKRKRKCLLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggagacggagctgttggtaaaacctgcctgctc
atcagttacacgaccaatgcatttcctggagagtacatccccaccgtctttgacaactat
tctgccaatgttatggtagatggaaaaccagtgaatctgggcctatgggacacagctgga
caagaagattatgacagattgcgtcccctctcctacccgcagacagacgtgttcttaatt
tgcttttcccttgtgagtcctgcatcatttgaaaatgtccgtgcaaagtggtatcctgaa
gtgcgacaccactgtcccaatactcctatcatcctcgtggggacgaagcttgatcttagg
gatgataaggacaccattgagaagctgaaggagaagaagctgactcccatcacctacccg
caggggctggccatggcgaaagagatcggtgctgtcaaatacctggagtgctcagctctc
acacagcgaggactcaagacagtgtttgacgaagctatccgagcggttctctgtccccct
cctgtcaagaagaggaagagaaaatgcctgctgttgtaa

DBGET integrated database retrieval system