KEGG   Mus musculus (mouse): 19354Help
Entry
19354             CDS       T01002                                 

Gene name
Rac2, AI323801, AI452260
Definition
RAS-related C3 botulinum substrate 2
Orthology
K07860  
Ras-related C3 botulinum toxin substrate 2
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Wnt signaling pathway
Axon guidance
VEGF signaling pathway
Focal adhesion
Adherens junction
Natural killer cell mediated cytotoxicity
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Pathways in cancer
Colorectal cancer
Pancreatic cancer
Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    19354 (Rac2)
   04015 Rap1 signaling pathway
    19354 (Rac2)
   04010 MAPK signaling pathway
    19354 (Rac2)
   04310 Wnt signaling pathway
    19354 (Rac2)
   04370 VEGF signaling pathway
    19354 (Rac2)
   04024 cAMP signaling pathway
    19354 (Rac2)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    19354 (Rac2)
  Cellular commiunity
   04510 Focal adhesion
    19354 (Rac2)
   04520 Adherens junction
    19354 (Rac2)
 Organismal Systems
  Immune system
   04650 Natural killer cell mediated cytotoxicity
    19354 (Rac2)
   04662 B cell receptor signaling pathway
    19354 (Rac2)
   04664 Fc epsilon RI signaling pathway
    19354 (Rac2)
   04666 Fc gamma R-mediated phagocytosis
    19354 (Rac2)
   04670 Leukocyte transendothelial migration
    19354 (Rac2)
   04062 Chemokine signaling pathway
    19354 (Rac2)
  Development
   04360 Axon guidance
    19354 (Rac2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    19354 (Rac2)
   05210 Colorectal cancer
    19354 (Rac2)
   05212 Pancreatic cancer
    19354 (Rac2)
  Cardiovascular diseases
   05416 Viral myocarditis
    19354 (Rac2)
GTP-binding proteins [BR:mmu04031]
 Small (Monomeric) G-proteins
  Rho Family
   Rac/Cdc42 [OT]
    19354 (Rac2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
15 E1; 15
AA seq 192 aa AA seqDB search
MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDSKPVNLGLWDTAG
QEDYDRLRPLSYPQTDVFLICFSLVSPASYENVRAKWFPEVRHHCPSTPIILVGTKLDLR
DDKDTIEKLKEKKLAPITYPQGLALAKDIDSVKYLECSALTQRGLKTVFDEAIRAVLCPQ
PTRQQKRPCSLL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgcaggccatcaagtgtgtggtggtgggtgatggagccgtgggcaagacgtgtcttctc
atcagctacaccaccaacgccttccctggagaatacatccccactgtatttgacaactac
tcagccaatgtgatggtggacagtaagccggtgaacctggggctgtgggataccgcaggt
caggaggactatgaccgcctccggccactctcctacccacagacagatgtatttctcatc
tgcttctcgctagtcagcccagcctcctatgagaatgtccgtgccaagtggttccctgag
gtacggcaccactgccccagcacccccatcatcctggtgggtaccaagctggaccttcgc
gatgacaaggacaccatcgagaagctgaaggagaagaagctggctcccatcacctacccg
cagggcctggcactggccaaggatattgattcagtcaagtacttggaatgttctgcactc
acccagcgaggcctgaagaccgtcttcgatgaggcaatccgcgcagtcctctgcccacag
cccacacgacagcagaagcgcccctgcagcctgctctag

DBGET integrated database retrieval system