KEGG   Mus musculus (mouse): 19374Help
Entry
19374             CDS       T01002                                 

Gene name
Rag2, Rag-2
Definition
recombination activating gene 2
Orthology
K10988  
recombination-activating protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
FoxO signaling pathway
Primary immunodeficiency
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04068 FoxO signaling pathway
    19374 (Rag2)
 Human Diseases
  Immune diseases
   05340 Primary immunodeficiency
    19374 (Rag2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
2 E2; 2 53.87 cM
AA seq 527 aa AA seqDB search
MSLQMVTVGHNIALIQPGFSLMNFDGQVFFFGQKGWPKRSCPTGVFHFDIKQNHLKLKPA
IFSKDSCYLPPLRYPATCSYKGSIDSDKHQYIIHGGKTPNNELSDKIYIMSVACKNNKKV
TFRCTEKDLVGDVPEPRYGHSIDVVYSRGKSMGVLFGGRSYMPSTQRTTEKWNSVADCLP
HVFLIDFEFGCATSYILPELQDGLSFHVSIARNDTVYILGGHSLASNIRPANLYRIRVDL
PLGTPAVNCTVLPGGISVSSAILTQTNNDEFVIVGGYQLENQKRMVCSLVSLGDNTIEIS
EMETPDWTSDIKHSKIWFGSNMGNGTIFLGIPGDNKQAMSEAFYFYTLRCSEEDLSEDQK
IVSNSQTSTEDPGDSTPFEDSEEFCFSAEATSFDGDDEFDTYNEDDEDDESVTGYWITCC
PTCDVDINTWVPFYSTELNKPAMIYCSHGDGHWVHAQCMDLEERTLIHLSEGSNKYYCNE
HVQIARALQTPKRNPPLQKPPMKSLHKKGSGKVLTPAKKSFLRRLFD
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgtccctgcagatggtaacagtgggtcataacatagccttaattcaaccaggcttctca
cttatgaattttgatggccaagttttcttctttggccagaaaggctggcctaagagatcc
tgtcctactggagtctttcattttgatataaaacaaaatcatctcaaactgaagcctgca
atcttctctaaagattcctgctacctcccacctcttcgttatccagctacttgctcatac
aaaggcagcatagactctgacaagcatcaatatatcattcacggagggaaaacaccaaac
aatgagctttccgataagatttatatcatgtctgtcgcttgcaagaataacaaaaaagtt
actttccgttgcacagagaaagacttagtaggagatgtccctgaacccagatacggccat
tccattgacgtggtgtatagtcgagggaaaagcatgggtgttctctttggaggacgttca
tacatgccttctacccagagaaccacagaaaaatggaatagtgtagctgactgcctaccc
catgttttcttgatagattttgaatttgggtgtgctacatcatatattctcccagaactt
caggatgggctgtcttttcatgtttctattgccagaaacgataccgtttatattttggga
ggacactcacttgccagtaatatacgccctgctaacttgtatagaataagagtggacctt
cccctgggtaccccagcagtgaattgcacagtcttgccaggaggaatctctgtctccagt
gcaatcctcactcaaacaaacaatgatgaatttgttattgtgggtggttatcagctggaa
aatcagaaaaggatggtctgcagccttgtctctctaggggacaacacgattgaaatcagt
gagatggagactcctgactggacctcagatattaagcatagcaaaatatggtttggaagc
aacatgggaaacgggactattttccttggcataccaggagacaataagcaggctatgtca
gaagcattctatttctatactttgagatgctctgaagaggatttgagtgaagatcagaaa
attgtctccaacagtcagacatcaacagaagatcctggggactccactccctttgaagac
tcagaggaattttgtttcagtgctgaagcaaccagttttgatggtgacgatgaatttgac
acctacaatgaagatgatgaagatgacgagtctgtaaccggctactggataacatgttgc
cctacttgtgatgttgacatcaatacctgggttccgttctattcaacggagctcaataaa
cccgccatgatctattgttctcatggggatgggcactgggtacatgcccagtgcatggat
ttggaagaacgcacactcatccacttgtcagaaggaagcaacaagtattattgcaatgaa
catgtacagatagcaagagcattgcaaactcccaaaagaaacccccccttacaaaaacct
ccaatgaaatccctccacaaaaaaggctctgggaaagtcttgactcctgccaagaaatcc
ttccttagaagactgtttgattaa

DBGET integrated database retrieval system