KEGG   Mus musculus (mouse): 19395Help
Entry
19395             CDS       T01002                                 

Gene name
Rasgrp2, CDC25L, Caldaggef1
Definition
(RefSeq) RAS, guanyl releasing protein 2
  KO
K12361  RAS guanyl-releasing protein 2
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04010  MAPK signaling pathway
mmu04014  Ras signaling pathway
mmu04015  Rap1 signaling pathway
mmu04062  Chemokine signaling pathway
mmu04611  Platelet activation
mmu05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    19395 (Rasgrp2)
   04015 Rap1 signaling pathway
    19395 (Rasgrp2)
   04010 MAPK signaling pathway
    19395 (Rasgrp2)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19395 (Rasgrp2)
   04062 Chemokine signaling pathway
    19395 (Rasgrp2)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    19395 (Rasgrp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RasGEF C1_1 EF-hand_1 EF-hand_6 EF-hand_5 EF-hand_7 RasGEF_N EF-hand_8
Motif
Other DBs
NCBI-GeneID: 19395
NCBI-ProteinID: NP_035372
MGI: 1333849
Ensembl: ENSMUSG00000032946
Vega: OTTMUSG00000018627
UniProt: Q9QUG9
Position
19; 19 A
AA seq 608 aa AA seqDB search
MTSTLDLDKGCTVEELLRGCIEAFDDSGKVRDPQLVRMFLMMHPWYIPSSQLASKLLHFY
QQSRKDNSNSLQMKTCHLVRYWISAFPAEFDLNPELAEQIKELKALLDQEGNRRHSSLID
IESVPTYKWKRQVTQRNPVEQKKRKMSLLFDHLEPMELAEHLTYLEYRSFCKILFQDYHS
FVTHGCTVDNPVLERFISLFNSVSQWVQLMILSKPTATQRALVITHFVHVAERLLQLQNF
NTLMAVVGGLSHSSISRLKETHSHVSPDTIKLWEGLTELVTATGNYSNYRRRLAACVGFR
FPILGVHLKDLVALQLALPDWLDPGRTRLNGAKMRQLFCILEELAMVTSLRPPVQANPDL
LSLLTVSLDQYQTEDELYQLSLQREPRSKSSPTSPTSCTPPPRPPVLEEWTSVAKPKLDQ
ALVAEHIEKMVESVFRNFDVDGDGHISQEEFQIIRGNFPYLSAFGDLDQNQDGCISREEM
ISYFLRSSSVLGGRMGFVHNFQESNSLRPVACRHCKALILGIYKQGLKCRACGVNCHKQC
KERLSVECRRRAQSVSLEGSAPSPSPTHTHHRAFSFSLPRPGRRSSRPPEIREEEVQSVE
DGVFDIHL
NT seq 1827 nt NT seq  +upstreamnt  +downstreamnt
atgacgagcactctggacctggacaagggctgcaccgtggaggagctgctccgtggttgc
atcgaagcgtttgatgactccggaaaggtgcgagatccacagctagtgcgcatgtttctc
atgatgcacccctggtacataccttcctctcagctggcttcgaaactgctccacttctat
cagcaatcccggaaggacaactccaattctctacagatgaaaacgtgtcacttggtcagg
tactggatctcagccttcccagcagagttcgacttgaacccagagctggctgaacagatc
aaggagctgaaggctctgttagaccaagaagggaaccgcaggcacagcagcctcatcgac
atcgagagtgtccctacctacaaatggaagcggcaggtgacccagcggaaccctgtggaa
cagaaaaagcgcaagatgtccttgttgtttgatcacttggagcctatggagctggcagaa
catcttacctacctggagtatcgttccttctgcaagatcctgttccaagactaccacagc
tttgtgactcatggctgcaccgtagacaacccggtcctggagcgattcatctccctcttc
aacagtgtctctcagtgggtccaactcatgatcctcagcaagcccacagccacgcagcgg
gcgctggtcatcacgcacttcgtgcatgtggcagagaggctgctgcagctgcagaacttc
aacacgctgatggccgtcgtgggaggcctgagccacagctccatctcacgcctcaaggag
acccacagccacgtcagccctgacaccatcaagctctgggaaggtctgacagaactagtg
acagctactggcaactacagcaactaccggcgcaggctggcagcctgcgtgggcttccgc
tttcctatcctgggagtgcacctcaaggatctagtggctctgcagctggctctgcctgac
tggctggacccaggtcggacccggctcaatggagccaagatgaggcagcttttctgcatt
ctggaggagttggccatggtgaccagccttcgcccacccgtacaagccaaccccgacctg
ctgagcctgctcacggtgtccctggatcagtatcagacagaggatgagctgtaccagctc
tcactgcagcgagagccacgctccaagtcgtcgccaaccagccccaccagctgcaccccg
cctccccggccccctgtgttggaagagtggacctcagttgccaagcctaagctggaccaa
gccttggtggcagagcacattgagaagatggtggagtctgtgttccggaactttgacgtg
gatggggacggtcacatctcccaggaggagtttcagatcatccggggcaacttcccttat
ctcagcgcctttggggacctggaccagaaccaggatggctgcatcagccgggaggagatg
atttcctacttcctgcgctccagctccgtgctgggaggccgcatgggcttcgtacacaac
ttccaggagagtaactcgctacgcccggttgcctgtcgccactgcaaagctctgatcctg
ggcatctacaagcagggccttaaatgtagagcttgtggtgtgaactgccacaagcaatgc
aaagagcgcctgtcagtggaatgtcgccgcagggcccagagtgtcagcctggagggctct
gcaccctctccctcacccacacatacccaccatcgggccttcagcttttccctgcctcgc
ccaggcaggcgcagctctcggcctccagagatccgtgaagaggaggtgcagtcggtggag
gacggagtgtttgacatccacttataa

DBGET integrated database retrieval system