KEGG   Mus musculus (mouse): 19417Help
Entry
19417             CDS       T01002                                 

Gene name
Rasgrf1, AI844718, CDC25, CDC25Mm, Gnrp, Grf1, Grfbeta, P190-A, Ras-GRF1, p190, p190RhoGEF
Definition
(RefSeq) RAS protein-specific guanine nucleotide-releasing factor 1
  KO
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    19417 (Rasgrf1)
   04010 MAPK signaling pathway
    19417 (Rasgrf1)
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    19417 (Rasgrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Structure
PDB: 

Jmol
Position
9 E3.1; 9 47.31 cM
AA seq 1262 aa AA seqDB search
MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFALLQNLLFYFESDSSP
RPSGLYLLEGSICKRAPSPKRGTSSKESGEKQQHYFTVNFSNDSQKTLELRTEDAKDCDE
WVAAIARASYKILATEHEALMQKYLHLLQVVETEKTVAKQLRQQLEDGEVEIERLKTEVT
ITNLIKDNDRIQSSNKAGSADDEDSDIKKIKKVQSFLRGWLCRRKWKNIIQDYIRSPHAD
SMRKRNQVVFSMLEAEAEYVQQLHILVNNFLRPLRMAASSKKPPITHDDVSSIFLNSETI
MFLHQIFYQGLKARISSWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQILAHCKQNRDF
DKLLKQYEAKPDCEERTLETFLTYPMFQIPRYILTLHELLAHTPHEHVERNSLDYAKSKL
EELSRIMHDEVSETENIRKNLAIERMITEGCEILLDTSQTFVRQGSLMQMSLSEKSKSSR
GRLGSLSTKKEGERQCFLFSKHLIICTRGSGGKLHLTKNGVISLIDCTLLDEPENLDDEA
KGAGPEIEHLEFKIGVEPKDSLPFTVILVASTRQEKAAWTSDIIQCVDNIRCNGLMMNAF
EENSKVTVPQMIKSDASLYCDDVDIRFSKTMNSCKVLQIRYASVERLLERLTDLRFLSID
FLNTFLHSYRVFTNAMVVLDKLINIYRKPMSAIPARSLELLFSSSHNAKLLYGDAPKSPR
ASRKFSSPPPLAIGTSSPSRRRKLSLNIPIITGGKALELASLGCSSDSYANIHSPISPFG
KTTLDTGKLCMASSLPKTPEEIDVPATIPEKPGELSASRKHSSDVLKEESEDDQNHSDED
NTEVSPVKSPPTPKSFLNRTITEFPFFNYNNGILMTTCRDLVDNNRSTLSATSAFAIATA
GANEGPSNKEVFRRMSLANTGFSSDQRNIDKEFVIRRAATNRVLNVLRHWVTKHTQDFDT
DDTLKYRVICFLEEVMHDPDLLTQERKAAANIIRTLTLEETTEQHSMLEEVILMTEGVKT
EPFENHPALEIAEQLTLLDHLVFKSIPYEEFFGQGWMKAEKYERTPYIMKTTKHFNHVSN
FIASEIIRNEDISARASAIEKWVAVADICRCLHNYNAVLEITSSINRSAIFRLKKTWLKV
SKQTKSLLDKLQKLVSSDGRFKNLRESLRNCDPPCVPYLGMYLTDLVFIEEGTPNYTEDG
LVNFSKMRMISHIIREIRQFQQTTYKIDPQPKVIQYLLDESFMLDEESLYESSLLIEPKL
PT
NT seq 3789 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagccatccggcttaacgatggccacgtcgtgaccctgggactgctggcacag
aaggacggcacgcgcaaaggctacctgagcaagaggagtgcggacaacccaaaatggcaa
accaagtggtttgccctgctccagaacctgcttttctacttcgaaagcgactccagccct
cggccctcggggctctacctgctcgagggaagtatctgtaaacgcgcgccctcccccaag
cgagggacctcctccaaggagtccggcgagaaacagcaacattacttcacagtgaacttc
tccaatgacagccagaagaccttggagttgaggaccgaggatgccaaggactgtgacgag
tgggtggctgcgatcgctcgcgccagctacaagatactggctacagaacatgaggcgctt
atgcagaagtacttacacctgctgcaggtagtggagacagagaagactgtggctaagcag
ctgcgccagcagcttgaggacggtgaggttgagatcgagcgcctgaagacggaggtaact
attacaaacctgatcaaggacaatgatcgtatccaatccagcaacaaagccggttctgct
gatgatgaggacagtgacatcaagaaaattaagaaggttcagagcttccttcggggatgg
ctgtgccggcgaaagtggaagaacatcatccaggactacatccggtctccccacgcggac
agcatgcgcaagaggaaccaggtggtgttcagcatgctggaggccgaggctgagtacgtc
cagcagctacacatccttgtcaacaacttcctgcgcccactgcgcatggccgccagctct
aagaaaccccctataacacacgacgacgtcagcagtatctttctgaacagcgagaccatc
atgttcctgcatcagatcttctaccaaggcctgaaggcccgtatctccagctggcccacc
ctggtgctggcggacctgttcgatatcctgctgcccatgctgaacatctaccaggagttc
gtccgcaaccaccagtacagcctccagatccttgctcactgcaagcaaaaccgggacttt
gacaagctcctcaagcagtacgaggccaagccagactgcgaggagcgcacactggagacc
ttcctcacctacccaatgttccagatccccaggtacatcctgacactccatgagctgctg
gcccacacacctcatgagcatgtggagcgcaacagcctggactatgccaaatccaaacta
gaggaactgtccaggatcatgcatgacgaagtcagtgaaaccgagaacatccgcaaaaac
ctggccattgagcgtatgatcacggagggctgtgagatcctcctggacaccagccagacc
ttcgtgcgccaaggttccctcatgcagatgtccttgtctgaaaagagcaagtcctctagg
ggccgcctggggtctctgtccactaagaaagagggtgagcgccagtgtttcctattctcc
aagcatctcattatctgcaccagaggctctggtgggaaactgcacctaaccaagaatgga
gtcatatccctcattgactgcaccttactggatgaacccgaaaacctggacgacgaagcc
aaaggagccggaccagagatagaacacctggagtttaagatcggggtggagccaaaggac
tccctacccttcactgtcatcctggtagcctcaaccaggcaggagaaggcagcatggacc
agtgacatcatccagtgcgtggataatatccgctgcaatgggctcatgatgaatgccttt
gaagaaaattccaaggtcaccgtgcctcagatgatcaagtctgacgcttccttatattgt
gatgatgttgacattcgcttcagcaaaaccatgaattcttgcaaagtgcttcagatccgc
tatgccagcgtggagcgcctgctggagcgcctgactgatcttcgcttcctgagcattgac
tttctcaacaccttcctgcattcctatcgcgtcttcaccaatgctatggtggtcctggac
aagctgatcaatatctacagaaaacccatgagtgcgattcctgccaggtccctggaactc
ttgttttccagcagccacaacgccaagcttctgtacggagatgcccctaagtcccctcgc
gccagccgcaagttctcctcgccaccgcccttggccatcgggacgtcatcccccagccgc
cgtcggaagctgtccctcaacatccccatcatcacaggcggcaaggcgctggaactggct
tcccttgggtgcagctccgatagctacgccaacatacactcacccatatctcccttcggc
aaaaccacactggacactggcaagctctgtatggccagcagcttacccaagactccagag
gagattgatgtgcctgccacgattccagagaagcctggggagctctcagcctccaggaag
catagctctgatgtcctgaaagaagagtccgaggatgaccagaaccacagtgatgaagac
aacacagaagtgtcaccagttaaatccccaccaacaccaaaatcgttcttaaacagaacc
attacagagtttccattctttaactacaacaatggaatcctgatgaccacgtgtcgtgat
ctggtggacaataaccgcagcactctctcagctacttctgcctttgccatagcgactgca
ggagccaatgaaggcccctcaaacaaggaggtgtttcgaaggatgtctttggccaacaca
ggcttttcctctgaccagagaaatatcgacaaggagtttgtgatccgcagagctgccacc
aatcgtgtgctgaatgtgctccgccactgggtcaccaagcacacccaggactttgatacc
gacgatacgctcaaatacagggtgatctgtttcctggaggaggtcatgcatgacccagac
cttctgacccaagagcgaaaggcagcagccaacatcatcaggactctgaccctagaagaa
acaactgaacaacatagcatgctggaagaagtcatactgatgacggagggtgtgaagact
gagcccttcgaaaaccacccagccctggagatagcagagcagctgaccctgctggatcac
cttgtcttcaagagtattccttatgaagagttctttggccagggctggatgaaggccgag
aagtatgaaaggacaccttacattatgaaaaccaccaaacacttcaaccatgtcagtaac
ttcattgcttcagaaattatccgaaacgaggacatcagcgcaagggcaagcgccatcgag
aagtgggtggctgtggccgacatatgtcgctgcctgcacaactacaatgctgtgctggag
atcacctcctccatcaaccgcagcgccatcttccgtctcaaaaagacatggctcaaagtt
tctaagcagacgaaatctttgcttgacaagctccaaaagcttgtgtcatcagatggcaga
tttaagaacctcagagagtctttgagaaattgtgatccaccctgtgtcccttacctgggg
atgtatctcaccgacttggtgttcatcgaggaggggacacccaattacacagaggacggc
ctggtcaacttctccaagatgagaatgatctcccatattatccgagagattcgccagttt
cagcagactacctacaaaatcgacccccagccaaaggtaattcagtacttactggatgaa
tctttcatgttggacgaagaaagcctgtatgagtcttcgctcctaatcgaaccaaaactc
cccacatga

DBGET integrated database retrieval system