KEGG   Mus musculus (mouse): 19417Help
Entry
19417             CDS       T01002                                 

Gene name
Rasgrf1, AI844718, CDC25, CDC25Mm, Gnrp, Grf1, Grfbeta, P190-A, Ras-GRF1, p190, p190RhoGEF
Definition
RAS protein-specific guanine nucleotide-releasing factor 1
Orthology
K04349  
Ras-specific guanine nucleotide-releasing factor 1
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Focal adhesion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    19417 (Rasgrf1)
   04010 MAPK signaling pathway
    19417 (Rasgrf1)
 Cellular Processes
  Cellular commiunity
   04510 Focal adhesion
    19417 (Rasgrf1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
9 E3.1; 9 47.31 cM
AA seq 178 aa AA seqDB search
MQKAIRLNDGHVVTLGLLAQKDGTRKGYLSKRSADNPKWQTKWFALLQNLLFYFESDSSP
RPSGLYLLEGSICKRAPSPKRGTSSKESGEKQRHSRSRRRRNVLRRQPTRISKTFRLVAI
ELTGMTATLEVSFSIIRTEIGTVAPAPQTWMGKPEDLTTLRDRVESKRLFHHPCRLII
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaagccatccggcttaacgatggccacgtcgtgaccctgggactgctggcacag
aaggacggcacgcgcaaaggctacctgagcaagaggagtgcggacaacccaaaatggcaa
accaagtggtttgccctgctccagaacctgcttttctacttcgaaagcgactccagccct
cggccctcggggctctacctgctcgagggaagtatctgtaaacgcgcgccctcccccaag
cgagggacctcctccaaggagtccggcgagaaacagcgtcatagcaggagtcgacgtcga
cgtaatgttctgagaagacaaccaaccaggatctcaaaaacattcaggctggtggcaatt
gaattgactgggatgacagccacccttgaagtctccttctccataattaggacagagatc
ggtaccgttgctccagctccacagacatggatgggaaagccagaagacttgacaacgctg
cgtgacagagtggagtcgaagcgtctcttccaccatccctgtagattgatcatttag

DBGET integrated database retrieval system