KEGG   Mus musculus (mouse): 19418Help
Entry
19418             CDS       T01002                                 

Gene name
Rasgrf2, 6330417G04Rik, AW048350, Grf2, Ras-GRF2
Definition
RAS protein-specific guanine nucleotide-releasing factor 2
Orthology
K12326  
Ras-specific guanine nucleotide-releasing factor 2
Organism
mmu  Mus musculus (mouse)
Pathway
MAPK signaling pathway
Ras signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    19418 (Rasgrf2)
   04010 MAPK signaling pathway
    19418 (Rasgrf2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
UniProt: 
Position
13 C3-D1; 13 47.43 cM
AA seq 1189 aa AA seqDB search
MQKSVRYNEGHALYLAMLARKEGTKRGFLSKKAAEASRWHEKWFALYQNVLFYFEGEQSG
RPAGMYLLEGCSCERTPAPPRTNAGPAGARDALDKQYYFTVLFGHDGQKPLELRCEEEQA
GKEWMEAIHQASYADILIEREVLMQKYIHLVQIVETEKIATNQLRHQLEDQDTEIERLKS
EIVALNKTKERMRPYHVHQEEEDPDIKKIKKVQSFMRGWLCRRKWKTIVQDYICSPHAES
MRKRNQIVFTMVEAETEYVHQLYILVNGFLRPLRMAASSKKPPINHDDVSSIFLNSETIM
FLHEIFHQGLKARLANWPTLVLADLFDILLPMLNIYQEFVRNHQYSLQVLANCKQNRDFD
KLLKQYEANPACEGRMLETFLTYPMFQIPRYIITLHELLAHTPHEHVERKSLEFAKSKLE
ELSRVMHDEVSDTENIRKNLAIERMIVEGCDILLDTSQTFIRQGSLIQVPSVERGKLSKV
RLGSLSLKKEGERQCFLFTKHFLICTRSSGGKLHLLKTGGVLSLIQCTLIEEPDGSDDDP
KGSGHMFGHLDFKIVVEPPDAASFTVVLLAPSRQEKAAWMSDISQCVDNIRCNGLMTIVF
EENSKVTVPHMIKSDARLHKDDTDICFSKTLNSCKVPQIRYASVERLLERLTDLRFLSID
FLNTFLHTYRIFTTATVVLAKLSDIYKRPFTSIPVRSLELFFATSQNNREHLVDGKSPRL
CRKFSSPPPLAVSRTSSPVRARKLSLTSSLNSRIGALDLTNSSSSSSPTTTTHSPAASPP
PHTAVLESAPADKAGDSADMSPCRSPTTPRHLRYRQPGGQVADSAHCSVSPASAFAIATA
AAGHGSPPGFNNERTCDKEFIIRRTATNRVLNVLRHWVSKHAQDFELNNELKMNVLNLLE
EVLRDPDLLPQERKATANILRALSQDDQDDIHLKLEDIIQMTDCPKAECFETLSAMELAE
QITLLDHIVFRSIPYEEFLGQGWMKLDKNERTPYIMKTSQHFNEMSNLVASQIMNYADIS
SRANAIEKWVAVADICRCLHNYNGVLEITSALNRSAIYRLKKTWAKVSKQTKALMDKLQK
TVSSEGRFKNLRETLKNCNPPAVPYLGMYLTDLAFIEEGTPNFTEEGLVNFSKMRMISHI
IREIRQFQQTAYRIDQQPKVIQYLLDKALVIDEDSLYELSLKIEPRLPA
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgcagaagagcgtgcgctacaacgaggggcacgccctgtacctggccatgctggcgcgc
aaggagggcaccaaacgcggcttcctgagcaagaaggctgcagaggcgagccgctggcac
gagaagtggttcgctctctaccagaatgtgctcttttacttcgaaggcgagcagagcggc
cggccagcgggcatgtaccttctagagggctgcagctgtgagcggacgcctgcaccaccc
aggaccaacgcaggacccgcaggcgcccgggacgctttggacaagcagtattacttcact
gtcctttttgggcacgatggtcaaaaaccactggagctgcgctgtgaggaggagcaggcc
gggaaagagtggatggaggccattcaccaagccagttacgcggacattttgatcgagagg
gaagtgctaatgcagaagtacattcatctagttcagattgtggagaccgagaagatcgcc
accaaccaactccgacatcaactcgaagatcaagataccgaaatcgaaaggcttaaatca
gagattgttgctcttaataagaccaaggaacggatgcgtccgtaccacgtccatcaagag
gaggaggatccagacatcaagaagattaagaaggttcagagcttcatgagagggtggctg
tgtaggaggaagtggaagaccatcgtgcaggactacatttgttctccccatgcagagagc
atgaggaagagaaaccagattgtgttcacgatggtggaggccgagacggagtatgtacac
cagctttacatcctggtgaacggtttcctcaggcccctgcgcatggcagccagctccaag
aagccccccattaaccacgatgacgtcagcagcatttttctcaacagtgaaacaatcatg
ttccttcatgaaatattccatcaaggactaaaggcaaggctggcaaattggcctactttg
gttttagcggatctatttgatattttgctgcccatgctgaacatttatcaagaatttgta
cgtaatcaccagtacagcctccaagtacttgccaactgtaagcaaaacagagattttgac
aagctcttaaagcagtatgaagccaaccctgcctgtgaggggaggatgctggagacgttc
ttgacctacccaatgtttcagattcccaggtatatcatcacgctgcacgaactcctggcc
cacaccccccatgaacatgtggagaggaaaagtctggagttcgctaagtccaagctggag
gaactgtccagagtgatgcatgatgaagtcagtgacaccgagaacatacggaaaaatctc
gccattgagaggatgatcgtagagggctgtgacattttgctggacaccagccaaactttt
atccgacaaggttcccttattcaagtgccttctgtggagagggggaaactgagtaaagtc
cgcctgggctcgctgtccctgaaaaaggaaggcgagagacagtgtttcttattcacgaag
cactttctgatttgtacacgaagttcaggaggaaagctgcatttgctcaagacaggtggg
gttctctccctcattcagtgtacattgattgaggagcccgatggaagtgacgatgacccc
aaaggttctggccacatgtttggacatctggattttaaaatcgtagtggagcctcctgac
gctgcctctttcactgtggtcttattggcaccttcacgccaggagaaggctgcatggatg
agcgacatcagtcagtgtgtggacaatatacgatgtaacggattgatgactatagtcttt
gaagagaattccaaagttactgtgccacatatgattaagtctgatgcccgtcttcacaaa
gacgacactgacatctgtttcagtaaaacactcaattcctgcaaagtgccccagatccgc
tacgccagcgtggagcgcctcttggagcggttgacggacttgcggtttctgagcattgat
ttcctcaacaccttcctgcacacctaccgcattttcaccacggccaccgtagtgctggca
aagctctcagacatctacaagaggcctttcacctccattcctgtcaggtcattagagtta
ttttttgccacaagccagaacaacagagaacatttggtagatggaaaatccccacgtctc
tgtcgcaagttctcttccccacctcccctggctgtgtccagaacatcctccccagtgagg
gccagaaagctgtctttgacgtcttccttgaactcaaggattggagccttggacctgact
aattcctcatcttccagtagtcccaccaccaccacccacagccctgctgcatccccacca
ccgcacactgctgtcttggagtctgcaccagccgacaaagcgggagattctgcagacatg
tcaccatgtagatcccccacaactccccggcacctccgctatcggcagcctggaggacag
gtagccgacagcgcccactgttctgtgtcacctgcttctgcttttgcaatcgccacagct
gcagcaggacatgggagtccaccaggatttaacaacgagagaacatgtgacaaggagttc
atcatacggagaacagccaccaatcgagtcctgaatgtcctccgccactgggtctcaaag
catgcccaggattttgaactcaataatgaactcaaaatgaatgttctaaacttgctagaa
gaagttctacgagacccggaccttcttcctcaagaaaggaaagcaacggcgaacatcctg
agggctctttcacaagatgatcaagatgatatccacctaaaattagaggatataattcaa
atgacagactgtccaaaggccgagtgctttgagacgttgtcagccatggagctggccgag
cagatcactctcctggaccacattgttttcagaagcatcccctacgaagagtttcttggg
cagggctggatgaagcttgacaagaacgaaaggacgccttacatcatgaaaaccagccag
cacttcaatgagatgagtaacctggtggcctcccagataatgaattatgccgacatcagc
tcccgtgccaacgccattgagaagtgggtggcagtggcggacatttgccgatgtctccac
aactacaatggtgttctggagatcacctcagccttaaacagaagtgccatctacaggctg
aagaaaacctgggccaaggtgtccaagcagacaaaagctctaatggacaaacttcagaag
actgtttcatctgaaggaagatttaaaaacctcagagagactctcaaaaactgtaacccc
ccagctgtcccttaccttgggatgtacttgacagatctggcattcattgaagaagggaca
ccgaactttaccgaagagggccttgtcaatttctccaaaatgcgaatgatatcacacatt
attcgagagatacgccagttccagcagaccgcttaccgcatagaccagcagccaaaggtc
atacaatacctgcttgacaaagcccttgtcatagacgaagattcactctatgagctgtca
ctcaaaattgaacctcgactccctgcttga

DBGET integrated database retrieval system