KEGG   Mus musculus (mouse): 195236Help
Entry
195236            CDS       T01002                                 

Gene name
Pom121l2, Gm24
Definition
POM121 membrane glycoprotein-like 2 (rat)
Orthology
K14316  
nuclear pore complex protein Nup121
Organism
mmu  Mus musculus (mouse)
Pathway
RNA transport
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    195236 (Pom121l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
13 A3.1; 13
AA seq 972 aa AA seqDB search
MGSYLGKAGSSPRSPAQGRADSGEKPASRRPARPLYQVHRVQHVHRAQPARRHRPARRPP
NWDPANPTAFVSEAWRRFPMKRPQNPIMGSLPSDWWESYLKRNIWSLRHPRATWSPVTVK
ISPPERRPRPLFPVSRVVNSAGPSEEPPGPCGKDPVLRALLQCRKGRARWEEPLFPDTSD
SQRHSASVWSAFKPLLKSGATVSFVARPGSLKRRPHVQSSDDKCKRSGCFSGALVASIHT
QGPPSTKRNAITSSYSSSRELSGSWKRHFLRTLVQTPEWPLKKAGESPNSHLSVTPSSSG
QLNGEIPLLQSGPRDLLTIPCQQGPVVTEEDPTLEGQAVPSNQTTEATTGTAGDSIPEMR
AGIQPTLSLSRSSSERVLSTHVNPQLESLKNMPAPLGCSQLEHIQGISSDSNPSIASTQA
SPSSPTTPVTDSTWLSSIPRAHRSAVPPHSSVINPTAPTTQSTLVGVVSNPILHLPASVL
PVETSSHLALRPIWGPVHSTEVRTASYSRISVMAEASSSSSPSTTPGILRPTFKPIFGSI
EPLQTMSETAPVHTRQPSSSLSSDSTHLFHSLATTAPCVVTSVIPASKSKDPGVDLNIVT
STTGNSCSVPSCSTFLLGASQNFPSATDLIFPSQHPTIPTVHTVTIFSQVLTSAIKISPL
RSTDTLKGVSNPLATLGLSSTNQPPVTSSNSNVTSALTSSLGSSPKPLLPPSQRNTSQSS
PGAIDGLKQSSLQLAPAQSFSTSFLSENSGVSPTPSAQLVLSKTTQPACGQLTSSAPIIH
TPATSQTGFGSTLAGFPFGKASSTALRVIRQNHQSVTYSSVFGSTAPRPFAFGGLVMPMD
CGEPEVIVAAPKRSTSGTRQSMTPSTLAPFVQCWNQSMQGPPNQITPLAGIPARKIMSGA
PSLVPFAQSIPVPGAIKAGSSLGFGMSSPTVQGSVGRNPLRSLEPSFCIGTKSKTLRNRE
PGRSRKHHTYKK
NT seq 2919 nt NT seq  +upstreamnt  +downstreamnt
atgggcagctacctgggcaaagcggggtcctcgccgcggtccccagcacaggggcgcgca
gactcaggggagaagcctgcgagccgccgacccgctaggcccctctaccaggtccaccgg
gtgcagcatgtccaccgcgcccagcccgctcggagacacaggccggcccggaggccgccc
aactgggatcccgccaaccctaccgctttcgtcagtgaggcctggaggcgcttccccatg
aagaggccacagaaccccatcatgggctctcttccttcagactggtgggaaagttacctg
aagcgtaatatttggtcccttcgtcaccctcgggccacatggagtccggtgacagtcaag
atctcgcctcctgagcggagaccacggcccttgttcccggtctcaagagtggtgaactcc
gcgggaccttcagaggagccaccagggccctgtggaaaggacccggtgctgagggccctc
ctccagtgcaggaagggcagagccaggtgggaagagccactgttcccggacacctccgac
agccaaaggcattcggcctccgtatggtccgcctttaagcccctgttgaaaagtggggcc
actgtttcgtttgtggccaggcctgggtctctgaaaaggagaccccatgtccagagctca
gatgataaatgtaagagatccggttgcttctctggggcccttgtggccagcatacatacc
caaggcccccccagcacaaaaagaaatgctattaccagttcttacagttcttctagagag
ctctcaggatcttggaagagacattttctcaggacattagtccagactccagaatggcca
ttgaaaaaagcaggagagagtcctaattctcacctctcagtcacacccagcagctctgga
cagctaaatggagagattcctctactgcagtctggccctagggacctgctaactatacct
tgccagcaaggtcctgttgtcactgaagaggacccaacattagaggggcaagctgtgccg
agcaaccaaaccacagaagctacaaccgggacagccggagactccattccagagatgagg
gctggaattcagcctaccttgtctctcagtcggtcgtcttctgagagagttcttagcacc
cacgtgaaccctcagctggaaagcttgaagaatatgcctgccccactcgggtgctcacag
ttagagcacatccaaggcatctcttcagactcaaatccctcaattgcttccacccaggcg
tctccaagctctcccacaacaccagtcactgattccacctggctatcttcaatccctcgg
gctcacaggtctgctgtgcccccacactcatctgtcattaaccccacagcacccaccaca
caaagcactttggttggggtggtgagtaacccaattctccatcttcctgcatctgtactt
cccgtggagacgtcttctcacttagcattaagacctatttgggggcctgttcacagtact
gaggttagaactgcctcatactccagaatttctgtcatggctgaggcctcttcaagctct
tctccctctacaactccaggtatcttaaggcccaccttcaagcctatctttggcagtata
gaaccgcttcaaactatgtctgagacagctcctgtgcacaccaggcagccctcttcttca
ctgagttctgattctacccatcttttccacagcctagccaccacagccccctgtgtggtt
acgtctgtcattccagccagcaaatccaaagaccctggtgtggatttgaacatagtgacc
agcaccacaggcaactcttgctctgtcccttcttgcagcactttcctgcttggagcttcc
cagaactttccctcggccactgatttaattttcccttcccaacaccccacaattcccact
gtacacacggtcactatctttagccaggttcttactagtgccatcaagatatcccctctt
agaagcactgatacactgaagggggtgagcaaccctctggcaactttgggcttatcgtcc
acaaaccagcctccagtgacctcaagcaactccaatgtgacttcagcactcacatcatct
ttggggtcaagcccaaagccacttttgccaccatcccaaagaaatacttctcaaagctca
cctggggccatagatgggctaaagcaatcttctctccagctagctcctgcccaaagcttc
agtacctctttcctttcagagaactcaggtgtgtctccaaccccatctgctcaactggtc
cttagcaagaccacacagccagcttgtgggcagttgacatcgtcagctcccattattcac
actcctgccaccagtcagacaggctttggcagcactctggctgggtttccattcggcaaa
gctagttcaactgcccttagggttatcaggcagaaccaccagagtgtgacctacagttca
gtttttggcagcacagccccaagaccttttgcttttggaggattagtgatgcctatggat
tgtggggagcctgaggtcattgtggctgcccccaaaaggagcacttctggcacaagacag
agtatgaccccaagcaccctagctccctttgtgcaatgctggaaccagagtatgcagggc
cctcctaaccagatcacacctttggctggcattcctgcaagaaagatcatgtctggggcc
ccctccctggtcccctttgctcagagtatccctgtacctggagcaattaaggcaggtagc
agtcttggctttgggatgtcctctcccactgttcagggttctgtggggagaaatcctttg
agatcattggaaccttcattctgtattggtacaaaatcaaaaacactaaggaaccgagag
ccagggcgctcccggaaacatcacacttacaagaaatag

DBGET integrated database retrieval system