KEGG   Mus musculus (mouse): 19701Help
Entry
19701             CDS       T01002                                 

Gene name
Ren1, D19352, Ren, Ren-1, Ren-A, Ren1c, Ren1d, Rn-1, Rnr
Definition
(RefSeq) renin 1 structural
  KO
K01380  renin [EC:3.4.23.15]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu04614  Renin-angiotensin system
mmu04924  Renin secretion
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04924 Renin secretion
    19701 (Ren1)
   04614 Renin-angiotensin system
    19701 (Ren1)
Enzymes [BR:mmu01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.15  renin
     19701 (Ren1)
Peptidases [BR:mmu01002]
 Aspartic Peptidases
  Family A1: pepsin family
   19701 (Ren1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Asp TAXi_N A1_Propeptide TAXi_C Asp_protease_2
Motif
Other DBs
NCBI-GeneID: 19701
NCBI-ProteinID: NP_112469
MGI: 97898
Ensembl: ENSMUSG00000070645
Vega: OTTMUSG00000021617
UniProt: P06281
Structure
PDB: 

Jmol
Position
1 E4; 1 57.91 cM
AA seq 402 aa AA seqDB search
MDRRRMPLWALLLLWSPCTFSLPTRTATFERIPLKKMPSVREILEERGVDMTRLSAEWGV
FTKRPSLTNLTSPVVLTNYLNTQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYL
ACGIHSLYESSDSSSYMENGSDFTIHYGSGRVKGFLSQDSVTVGGITVTQTFGEVTELPL
IPFMLAKFDGVLGMGFPAQAVGGVTPVFDHILSQGVLKEEVFSVYYNRGSHLLGGEVVLG
GSDPQHYQGNFHYVSISKTDSWQITMKGVSVGSSTLLCEEGCAVVVDTGSSFISAPTSSL
KLIMQALGAKEKRIEEYVVNCSQVPTLPDISFDLGGRAYTLSSTDYVLQYPNRRDKLCTL
ALHAMDIPPPTGPVWVLGATFIRKFYTEFDRHNNRIGFALAR
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atggacagaaggaggatgcctctctgggcactcttgttgctctggagtccttgcaccttc
agtctcccaacacgcaccgctacctttgaacgaatcccgctcaagaaaatgccttctgtc
cgggaaatcctggaggagcggggagtggacatgaccaggctcagtgctgaatggggcgta
ttcacaaagaggccttccttgaccaatcttacctcccccgtggtcctcaccaactacctg
aatacccagtactacggcgagattggcatcggtaccccaccccagaccttcaaagtcatc
tttgacacgggttcagccaacctctgggtgccctccaccaagtgcagccgcctctacctt
gcttgtgggattcacagcctctatgagtcctctgactcctccagctacatggagaacggg
tccgacttcaccatccactacggatcagggagagtcaaaggtttcctcagccaggactcg
gtgactgtgggtggaatcactgtgacacagacctttggagaggtcaccgagctgcccctg
atccctttcatgctggccaagtttgacggtgttctaggcatgggctttcccgctcaggcc
gttggcggggttacccctgtctttgaccacattctctcccagggggtgctaaaggaggaa
gtgttctctgtctactacaacaggggttcccacctgctggggggcgaggtggtgctagga
ggtagcgacccgcagcattatcaaggcaattttcactatgtgagcatcagcaagactgac
tcctggcagatcacgatgaagggggtgtctgtggggtcttccaccctgctatgtgaagaa
ggctgtgcggtagtggtggacactggttcatcctttatctcggctcctacgagctccctg
aagttgatcatgcaagccctgggagccaaggagaagagaatagaagaatatgttgtgaac
tgtagccaggtgcccaccctccccgacatttcctttgacctgggaggcagggcctacaca
ctcagcagtacggactacgtgctacagtatcccaacaggagagacaagctgtgcacactg
gctctccatgccatggacatcccaccacccactgggcctgtctgggtcctgggtgccacc
ttcatccgcaagttctatacagagtttgatcggcataacaatcgcattggattcgccttg
gcccgctaa

DBGET integrated database retrieval system