KEGG   Mus musculus (mouse): 19729Help
Entry
19729             CDS       T01002                                 

Gene name
Slc50a1, MmSWEET1, Rag1ap1, Rga
Definition
(RefSeq) solute carrier family 50 (sugar transporter), member 1
  KO
K15382  solute carrier family 50 (sugar transporter)
Organism
mmu  Mus musculus (mouse)
Brite
Transporters [BR:mmu02000]
 Solute Carrier Family (SLC)
  SLC50: Sugar efflux transporter
   19729 (Slc50a1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MtN3_slv PQ-loop
Motif
Other DBs
NCBI-GeneID: 19729
NCBI-ProteinID: NP_033083
MGI: 107417
Ensembl: ENSMUSG00000027953
Vega: OTTMUSG00000021858
UniProt: Q9CXK4
Position
3 F1; 3 39.04 cM
AA seq 221 aa AA seqDB search
MEAGGVADSFLSSACVLFTLGMFSTGLSDLRHMQRTRSVDNIQFLPFLTTDVNNLSWLSY
GVLKGDGTLIIVNSVGAVLQTLYILAYLHYSPQKHGVLLQTATLLAVLLLGYGYFWLLVP
DLEARLQQLGLFCSVFTISMYLSPLADLAKIVQTKSTQRLSFSLTIATLFCSASWSIYGF
RLRDPYITVPNLPGILTSLIRLGLFCKYPPEQDRKYRLLQT
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgggcggcgtggcagactctttcctttctagtgcctgcgtgctcttcaccctg
ggcatgttctccactggcctctcggacctcaggcatatgcagaggacacggagcgtggac
aacatccagttcctgccttttctcaccacggatgtcaacaacctgagctggctgagttac
ggagtcttgaagggagatgggacccttatcatcgtcaatagcgtgggggccgtgcttcag
actctttatatcctggcatatctgcactacagtcctcagaagcatggtgtgctcctgcag
acggcaaccctgctggctgtccttctcctgggttatggctacttttggcttctggtgccg
gaccttgaggcccggcttcagcagctaggcctcttctgtagcgtctttaccatcagcatg
tacctctccccactggctgatttggccaagatcgttcagactaaatcaacccagcgcctc
tccttctccctgaccattgccacgctcttttgctccgcctcttggtctatttacgggttt
cgcctccgagacccatacatcacggtgcccaaccttccaggaatcctcaccagcttaatc
cgcctcgggcttttctgcaagtaccctccagagcaagacaggaagtaccgcctcctgcag
acctga

DBGET integrated database retrieval system