KEGG   Mus musculus (mouse): 19735Help
Entry
19735             CDS       T01002                                 

Gene name
Rgs2, GOS8
Definition
(RefSeq) regulator of G-protein signaling 2
  KO
K18154  
regulator of G-protein signaling 2
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
Olfactory transduction
Oxytocin signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04022 cGMP - PKG signaling pathway
    19735 (Rgs2)
 Organismal Systems
  Endocrine system
   04921 Oxytocin signaling pathway
    19735 (Rgs2)
  Sensory system
   04740 Olfactory transduction
    19735 (Rgs2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 F; 1 62.56 cM
AA seq 211 aa AA seqDB search
MQSAMFLAVQHDCVPMDKSAGNGPKVEEKREKMKRTLLKDWKTRLSYFLQNSSAPGKPKT
GKKSKQQTFIKPSPEEAQLWAEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKSLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgcaaagtgccatgttcctggctgtccagcacgactgcgtacccatggacaagagtgca
ggcaacggccccaaggtcgaggagaagcgggagaaaatgaagcggacactcttaaaggat
tggaagacccgtttgagctacttcttgcagaattcctctgctcctgggaagcccaaaact
ggcaagaaaagcaaacagcaaacttttatcaagccttctcctgaggaagcgcagctctgg
gcagaagcatttgatgaactgctggccagtaaatatgggctggctgcattcagggcgttt
ttaaagtccgagttctgtgaagaaaacattgaattctggttggcttgtgaagacttcaaa
aaaaccaaatcaccccaaaaactgtcctcaaaagcaaggaaaatctataccgacttcata
gagaaggaagctcccaaagagataaacatagacttccaaacgaaatctctgattgcccaa
aatatccaagaggctacaagtggctgcttcaccacagctcagaagagggtgtacagtttg
atggagaacaattcttatcctcggttcttggagtccgaattctaccaggacttatgtaaa
aagccacagatcaccacggagccccatgctacatga

DBGET integrated database retrieval system