KEGG   Mus musculus (mouse): 19752Help
Entry
19752             CDS       T01002                                 

Gene name
Rnase1, AI574248, Rib-1, Rib1
Definition
ribonuclease, RNase A family, 1 (pancreatic) (EC:3.1.27.5)
Orthology
K01168  
pancreatic ribonuclease [EC:3.1.27.5]
Organism
mmu  Mus musculus (mouse)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Structure
PDB: 

Jmol
Position
14 B-C1; 14 26.4 cM
AA seq 149 aa AA seqDB search
MGLEKSLILFPLFVLLLGWVQPSLGRESAAQKFQRQHMDPDGSSINSPTYCNQMMKRRDM
TNGSCKPVNTFVHEPLADVQAVCSQENVTCKNRKSNCYKSSSALHITDCHLKGNSKYPNC
DYKTTQYQKHIIVACEGNPYVPVHFDATV
NT seq 450 nt NT seq  +upstreamnt  +downstreamnt
atgggtctggagaagtccctcattctgtttccattgtttgtcctgctgcttggatgggtc
cagccttccctgggcagggaatctgcagcacagaagtttcagcggcagcacatggatcca
gatggttcctccatcaacagccccacctactgcaaccaaatgatgaaacgccgggatatg
acaaatgggtcatgcaagcccgtgaacaccttcgtgcatgagcccttggcagatgtccag
gctgtctgctcccaggaaaatgtcacctgcaagaacaggaagagcaactgctacaagagc
agctctgccctgcacatcactgactgccacctgaagggcaactccaagtatcccaactgt
gactacaagaccactcaataccagaagcacatcattgtggcctgtgaagggaacccctac
gtaccagtccactttgatgctactgtgtag

DBGET integrated database retrieval system