KEGG   Mus musculus (mouse): 19877Help
Entry
19877             CDS       T01002                                 

Gene name
Rock1, 1110055K06Rik, Rock-I
Definition
(RefSeq) Rho-associated coiled-coil containing protein kinase 1 (EC:2.7.11.1)
  KO
K04514  
Rho-associated protein kinase 1 [EC:2.7.11.1]
Organism
mmu  Mus musculus (mouse)
Pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
Sphingolipid signaling pathway
Vascular smooth muscle contraction
TGF-beta signaling pathway
Axon guidance
Focal adhesion
Platelet activation
Leukocyte transendothelial migration
Regulation of actin cytoskeleton
Oxytocin signaling pathway
Salmonella infection
Pathways in cancer
Proteoglycans in cancer
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Environmental Information Processing
  Signal transduction
   04350 TGF-beta signaling pathway
    19877 (Rock1)
   04071 Sphingolipid signaling pathway
    19877 (Rock1)
   04024 cAMP signaling pathway
    19877 (Rock1)
   04022 cGMP - PKG signaling pathway
    19877 (Rock1)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    19877 (Rock1)
  Cellular commiunity
   04510 Focal adhesion
    19877 (Rock1)
 Organismal Systems
  Immune system
   04611 Platelet activation
    19877 (Rock1)
   04670 Leukocyte transendothelial migration
    19877 (Rock1)
   04062 Chemokine signaling pathway
    19877 (Rock1)
  Endocrine system
   04921 Oxytocin signaling pathway
    19877 (Rock1)
  Circulatory system
   04270 Vascular smooth muscle contraction
    19877 (Rock1)
  Development
   04360 Axon guidance
    19877 (Rock1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    19877 (Rock1)
   05206 MicroRNAs in cancer
    19877 (Rock1)
   05205 Proteoglycans in cancer
    19877 (Rock1)
  Infectious diseases
   05132 Salmonella infection
    19877 (Rock1)
Enzymes [BR:mmu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     19877 (Rock1)
Protein kinases [BR:mmu01001]
 Serine/threonine protein kinases: AGC group
  DMPK family [OT]
   19877 (Rock1)
Chromosome [BR:mmu03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    19877 (Rock1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
18; 18 A2
AA seq 1354 aa AA seqDB search
MSTGDSFETRFEKIDNLLRDPKSEVNSDCLLDGLDALVYDLDFPALRKNKNIDNFLSRYK
DTINKIRDLRMKAEDYEVVKVIGRGAFGEVQLVRHKSTRKVYAMKLLSKFEMIKRSDSAF
FWEERDIMAFANSPWVVQLFYAFQDDRYLYMVMEYMPGGDLVNLMSNYDVPEKWARFYTA
EVVLALDAIHSMGFIHRDVKPDNMLLDKSGHLKLADFGTCMKMNKEGMVRCDTAVGTPDY
ISPEVLKSQGGDGYYGRECDWWSVGVFLYEMLVGDTPFYADSLVGTYSKIMNHKNSLTFP
DDNDISKEAKNLICAFLTDREVRLGRNGVEEIKRHLFFKNDQWAWETLRDTVAPVVPDLS
SDIDTSNFDDLEEDKGDEETFPIPKAFVGNQLPFVGFTYYSNRRYLPSANASENRSSSNV
DKSLQESLQKTIYKLEEQLHNEMQLKDEMEQKCRTSNLKLDKIMKELDEEGNQRRNLESA
VSQIEKEKMLLQHRINEYQRKVEQENEKRRNIENEVSTLKDQLEDLRKASQTSQLANEKL
TQLQKQLEEANDLLRTESDTAVRLRKSHTEMSKSISQLESLNRELQERNRILENSKSQAD
KDYYQLQAVLEAERRDRGHDSEMIGDLQARITSLQEEVKHLKHNLERVEGERKEAQDMLN
HSEKEKNNLEIDLNYKLKSIQQRLEQEVNEHKVTKARLTDKHQSIEEAKSVAMCEMEKKL
KEEREAREKAENRVVETEKQCSMLDVDLKQSQQKLEHLTENKERMEDEVKNLALQLEQES
NKRLLLQNELKTQAFEADNLKGLEKQMKQEINTLLEAKRLLEFELAQLTKQYRGNEGQMR
ELQDQLEAEQYFSTLYKTQVKELKEEIEEKNRENLRKIQELQSEKETLSTQLDLAETKAE
SEQLARGILEEQYFELTQESKKAASRNRQEITDKDHTVSRLEETNSVLTKDIEMLRKENE
ELNERMRTAEEEYKLKKEEEINNLKAAFEKNISTERTLKTQAVNKLAEIMNRKDFKIDRK
KANTQDLRKKEKENRKLQLELNQEREKFNQMVVKHQKELNDMQAQLVEECTHRNELQMQL
ASKESDIEQLRAKLLDLSDSTSVASFPSADETDGNLPESRIEGWLSVPNRGNIKRYGWKK
QYVVVSSKKILFYNDEQDKEQSSPSMVLDIDKLFHVRPVTQGDVYRAETEEIPKIFQILY
ANEGECRKDIEVEPVQQGEKTNFQNHKGHEFIPTLYHFPANCEACAKPLWHVFKPPPALE
CRRCHVKCHRDHLDKKEDLISPCKVSYDVTSARDMLLLACSQDEQKKWVTHLVKKIPKNP
PSGFVRASPRTLSTRSTANQSFRKVVKNTSGKTS
NT seq 4065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgactggggacagttttgagactcggtttgaaaaaatcgacaacctgctgcgggat
cccaaatcggaagtgaattcagattgtttgctggatggattggatgccctggtttatgat
ttggattttcctgccttaagaaaaaacaaaaatattgacaactttctaagcagatataaa
gacacaataaataaaattagagatttacggatgaaagcagaagattatgaagtggtaaag
gtaatcggcagaggtgcatttggagaagttcaattggtgaggcataaatccactaggaag
gtttatgctatgaagctgctcagcaaatttgaaatgattaagagatcggattctgctttt
ttctgggaagaaagggacatcatggcgtttgccaatagtccttgggttgttcagcttttt
tatgcattccaagatgaccggtatctctacatggtgatggagtacatgcctggcggagac
cttgtcaacctgatgagcaactatgacgtgcctgaaaaatgggcaagattctatactgca
gaagtagttcttgcattggatgcaatccattccatgggttttattcatagagatgtaaag
cctgataacatgctgctggataagtctggacatttgaagttagcagattttggtacttgt
atgaagatgaataaggaaggtatggtacgatgtgacacagcagttggaacacctgattat
atctcacccgaagtattaaaatcccaaggcggtgatggctattatggacgagagtgtgac
tggtggtcagttggggtatttctatatgaaatgctcgtaggtgacacacctttctatgca
gattctttggttgggacttacagtaaaattatgaaccataaaaattcacttactttccct
gatgataatgacatatcaaaagaggcaaaaaatctcatttgtgccttccttacagacaga
gaagtgagattgggcagaaatggtgtagaggaaatcaaacgtcatctcttcttcaaaaat
gatcagtgggcttgggaaacgctccgagacactgtagcaccagttgtgcctgatttaagt
agtgacattgatactagtaattttgatgacttagaagaagataaaggagatgaagaaaca
tttcctattccaaaagcttttgttggcaatcagctaccttttgtaggatttacatattat
agcaatcgtagatacttaccttcagcaaatgccagtgagaacagatctagctccaatgtg
gataaaagcttgcaggaaagtttacagaaaacaatctacaagcttgaagagcaactgcat
aatgaaatgcaattaaaagatgaaatggagcagaaatgcagaacttcaaacttaaaacta
gacaagataatgaaagaattggatgaagaggggaatcaaagaagaaatctagaatctgca
gtgtctcaaattgagaaagaaaagatgttgctacaacatagaattaatgagtaccaaaga
aaagtggaacaggaaaatgagaagagaagaaatatagaaaatgaagtttctacactaaag
gaccagttagaagacttacggaaagcaagtcagacctcacagcttgctaatgagaagctg
acacagttacagaagcagttagaagaagcgaatgacttacttaggacagaatcagacaca
gctgtaagattaaggaagagtcacacagagatgagcaagtcaattagtcagctagagtcc
ctgaacagagaattacaggaaagaaacagaattttagagaattccaagtcacaagcagac
aaggattactaccagctgcaagctgtattggaagctgagcgaagagacagagggcatgat
tctgagatgattggagaccttcaagcacgaattacatctttacaagaagaagtgaaacat
ctcaaacataatcttgaaagagtggaaggagaaagaaaagaggctcaagacatgcttaat
cattcagaaaaggaaaagaataatttggagatagatttgaattacaagctcaagtctata
caacagcggttagaacaagaagtaaatgaacataaagtcaccaaagcacgcctaactgac
aagcaccaatctatcgaagaggcaaagtctgttgccatgtgtgaaatggaaaaaaagctg
aaggaagagagagaagctcgagagaaggcagaaaatagagttgttgagactgagaaacaa
tgttccatgctagatgttgacctgaaacagtctcagcagaagctagaacatttgaccgaa
aataaagaaaggatggaggatgaagttaagaatctcgccctgcagctggaacaggaatca
aataaacggctcttgttacagaatgaattgaagactcaagcatttgaagcagacaattta
aaaggtttagaaaaacagatgaaacaggaaataaatactttattggaagcaaagagattg
ttagaatttgagttagctcagcttacaaagcaatataggggaaatgaagggcaaatgcgg
gagttacaagatcaacttgaagctgagcagtatttctctacactttataaaacccaagta
aaggagcttaaagaagaaattgaagaaaaaaaccgagaaaatttaaggaaaatacaggaa
ctgcaaagtgaaaaagaaactctctctactcagttggatttagcagaaacaaaagctgag
tctgagcagctggcgcgagggattctggaagaacagtattttgagttgactcaggaaagc
aagaaagctgcttcaagaaatagacaagagattacagataaagatcatactgttagtcgg
cttgaagaaacaaacagtgtgctaaccaaagatattgaaatgctaagaaaagaaaatgaa
gagctaaatgaaagaatgaggacagcagaagaagaatataaattgaagaaggaggaagaa
ataaataatcttaaggctgcttttgaaaagaatatcagtaccgaacggacccttaaaaca
caggctgttaacaagttggcagaaataatgaatcgcaaagattttaaaattgatcgaaag
aaagctaatacacaagatttaagaaaaaaagaaaaggaaaatagaaagctacaactggaa
cttaaccaagagagagaaaaatttaaccaaatggtggtgaaacaccagaaggagctgaat
gacatgcaagcgcaattggtagaagaatgtacacatagaaatgaacttcaaatgcagttg
gctagcaaagagagtgatattgagcagttgcgggcaaaacttttggacctttcggattca
actagtgttgctagttttcctagtgcagatgaaactgatggaaaccttccagagtcaaga
attgaaggttggctttctgtaccaaatagaggaaatatcaaaagatatggctggaagaaa
cagtatgttgtggtaagcagcaaaaagatcttgttctataatgatgaacaagataaggaa
caatccagtccatctatggtgttagacatagataaattgtttcatgtccgacctgtaacc
caaggagatgtgtacagagcagaaactgaagaaattcctaaaatattccagatactatat
gcaaatgaaggtgaatgtagaaaagatatagaagtggaaccggttcaacaaggtgaaaaa
actaatttccagaatcacaaaggccatgaattcattcctaccctctaccactttcctgcc
aactgtgaggcctgtgccaaacctttgtggcatgtctttaagccaccacctgccctagag
tgtcgaagatgccatgttaagtgccacagagaccatctagacaagaaagaggacttgatt
tccccgtgcaaagtaagttacgatgtaacatcagcaagagatatgctgctgttagcatgt
tctcaggatgaacaaaaaaagtgggttactcatctagtaaagaagattcctaagaaccca
ccatctggctttgtccgtgcctctcctcgaacgctgtcaacaagatccactgcaaatcag
tctttccgcaaagtagtcaaaaatacatctggaaaaactagttaa

DBGET integrated database retrieval system