KEGG   Mus musculus (mouse): 19889Help
Entry
19889             CDS       T01002                                 

Gene name
Rp2, AI662636, Rp2h
Definition
(RefSeq) retinitis pigmentosa 2 homolog
  KO
K18272  
protein XRP2
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   19889 (Rp2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
X; X A2
AA seq 347 aa AA seqDB search
MGCCFTKRRKSEKAEGEEEQPKLYSWDQREKVDPKDYMFSGLKDETVGRLPGKVAGQQFV
IQDCENCNIYIFDHSATITIDDCTNCVIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCR
KLEVFLCCATQPIIESSTNIKFGCFQWYYPELAAQFKDAGLSIFNNIWSHVHDFTPVSGE
LNWSLLPENAVVQDYVPIPMTEEFKAVRISTEANRSIVPVSRGQRQKYSDESCLVVLFAD
DYTTANARKLIDEMVGKGFSLVQTKEMSMKTEDAQRVFQEKASDFLLLLNKGPVIALEFN
GDDAVQECHLIVNGMFNGTKMFVSEKKETASGDVDSFYNFAEIQMGI
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgggctgctgcttcactaagaggaggaagagtgaaaaggctgagggagaggaggagcag
cccaagctgtacagctgggaccagcgggagaaggttgatccaaaagattacatgtttagt
ggactgaaggatgaaacagtaggtcgcttacctggaaaagtggcaggacaacaatttgtc
attcaagactgtgagaactgtaacatctatatttttgaccactcagctactattaccatt
gatgactgcactaactgtgtaatttttttgggaccagtgaaaggcagtgtctttttccga
aattgtagagattgcaagtgcacattggcttgccagcaatttcgtgtgagagactgtaga
aagttggaagtctttttgtgctgtgctactcaacccattattgaatcttccacaaacatc
aagtttggctgttttcaatggtactaccctgaattagcagcccaattcaaagatgcaggc
ctcagtatcttcaataacatttggagtcatgttcatgattttacacctgtgtcaggagag
ctcaactggagccttcttccagaaaatgccgtggttcaagactatgttcctatcccaatg
actgaagaattcaaagctgtgcgaatttccacagaagccaatagaagcattgttcctgtg
tcccggggtcagagacagaagtacagtgatgaatcatgtcttgtggtattatttgccgat
gattatacaactgcaaatgccaggaaactaattgatgagatggttggtaaaggcttctcc
ctagtgcagacaaaggaaatgtcaatgaaaactgaagacgcccaaagggttttccaggaa
aaggcatcagattttttacttcttctaaacaaaggtcctgtgattgccttggaatttaat
ggagatgacgctgtacaagaatgtcaccttattgtaaatgggatgttcaacgggacaaag
atgtttgtatcagaaaagaaggagaccgcatctggagatgttgatagcttctataacttt
gctgagatccagatggggatatga

DBGET integrated database retrieval system