KEGG   Mus musculus (mouse): 19895Help
Entry
19895             CDS       T01002                                 

Gene name
Rpia, RPI
Definition
(RefSeq) ribose 5-phosphate isomerase A (EC:5.3.1.6)
  KO
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose phosphate pathway
Metabolic pathways
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    19895 (Rpia)
   01230 Biosynthesis of amino acids
    19895 (Rpia)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    19895 (Rpia)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     19895 (Rpia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 C1; 6 32.06 cM
AA seq 303 aa AA seqDB search
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRAHSETRGDKGGSSA
GGPAPSTMSKAEEAKKLASHTAVENHVKNNQVLGIGSGSTIVHAVQRIAERVKQENLDLI
CIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGGGGCLTQEKIVAG
YASRFIVIADFRKDSKNLGDRWHKGIPIEVIPMAYVPVSRAVAQKFGGEVELRMAVNKAG
PVVTDNGNFILDWKFDRVHKWSEVNTAIKMTPGVVDTGLFINMAERVYFGMQDGSVNVRE
KPF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgggcccttcagcaccctctacgggcgggtcctggccccactgcccggg
cgggccgggggcgcggcctcgggcgggggcgggaacaactggggcctctcgggttcccac
gtgcagttgccggggcgtgcacattcggagacccgcggcgacaagggaggctcgagcgcg
ggcggcccggccccctccacgatgtccaaggccgaggaggctaagaagctggcgagccac
acggcggtggagaaccacgtgaagaataaccaagtgctgggaattggaagtggttctaca
attgtccacgctgtgcagcgaatagctgaaagagtgaagcaagagaatctggacctcatc
tgcatccccacatctttccaggccaggcagcttatcttgcagtatggcttaaccctcagt
gacctggatcaacacccagagattgaccttgccatcgatggtgctgacgaagtggatgct
gagctcaatctcatcaagggtggaggaggctgcctgacccaggagaagatcgtggctggt
tatgcaagtcgtttcattgtgattgctgatttcaggaaagattcaaagaacctcggggat
cggtggcacaaggggattcccattgaagtcatcccaatggcctacgtcccagtgagccgg
gctgtggcccagaagtttgggggtgaggtggaacttcgaatggctgtcaacaaggcaggg
ccagtggtgacggataacgggaattttatcctggactggaagtttgaccgggtgcataaa
tggagtgaagtgaacacagctatcaaaatgactccaggcgtggtggacacaggccttttc
atcaacatggcagagagagtctactttgggatgcaggatggctcagtgaacgtgcgggag
aagcccttctag

DBGET integrated database retrieval system