KEGG   Mus musculus (mouse): 19895Help
Entry
19895             CDS       T01002                                 

Gene name
Rpia, RPI
Definition
ribose 5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    19895 (Rpia)
   01230 Biosynthesis of amino acids
    19895 (Rpia)
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    19895 (Rpia)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     19895 (Rpia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 C1; 6 32.06 cM
AA seq 303 aa AA seqDB search
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRAHSETRGDKGGSSA
GGPAPSTMSKAEEAKKLASHTAVENHVKNNQVLGIGSGSTIVHAVQRIAERVKQENLDLI
CIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGGGGCLTQEKIVAG
YASRFIVIADFRKDSKNLGDRWHKGIPIEVIPMAYVPVSRAVAQKFGGEVELRMAVNKAG
PVVTDNGNFILDWKFDRVHKWSEVNTAIKMTPGVVDTGLFINMAERVYFGMQDGSVNVRE
KPF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgggcccttcagcaccctctacgggcgggtcctggccccactgcccggg
cgggccgggggcgcggcctcgggcgggggcgggaacaactggggcctctcgggttcccac
gtgcagttgccggggcgtgcacattcggagacccgcggcgacaagggaggctcgagcgcg
ggcggcccggccccctccacgatgtccaaggccgaggaggctaagaagctggcgagccac
acggcggtggagaaccacgtgaagaataaccaagtgctgggaattggaagtggttctaca
attgtccacgctgtgcagcgaatagctgaaagagtgaagcaagagaatctggacctcatc
tgcatccccacatctttccaggccaggcagcttatcttgcagtatggcttaaccctcagt
gacctggatcaacacccagagattgaccttgccatcgatggtgctgacgaagtggatgct
gagctcaatctcatcaagggtggaggaggctgcctgacccaggagaagatcgtggctggt
tatgcaagtcgtttcattgtgattgctgatttcaggaaagattcaaagaacctcggggat
cggtggcacaaggggattcccattgaagtcatcccaatggcctacgtcccagtgagccgg
gctgtggcccagaagtttgggggtgaggtggaacttcgaatggctgtcaacaaggcaggg
ccagtggtgacggataacgggaattttatcctggactggaagtttgaccgggtgcataaa
tggagtgaagtgaacacagctatcaaaatgactccaggcgtggtggacacaggccttttc
atcaacatggcagagagagtctactttgggatgcaggatggctcagtgaacgtgcgggag
aagcccttctag

DBGET integrated database retrieval system