KEGG   Mus musculus (mouse): 19895Help
Entry
19895             CDS       T01002                                 

Gene name
Rpia, RPI
Definition
ribose 5-phosphate isomerase A (EC:5.3.1.6)
Orthology
K01807  
ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
Pentose phosphate pathway
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Pentose phosphate pathway (Pentose phosphate cycle)
Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Class
Metabolism; Overview; Carbon metabolism [PATH:mmu01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mmu01230]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:mmu00030]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
6 C1; 6 32.06 cM
AA seq 303 aa AA seqDB search
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRAHSETRGDKGGSSA
GGPAPSTMSKAEEAKKLASHTAVENHVKNNQVLGIGSGSTIVHAVQRIAERVKQENLDLI
CIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGGGGCLTQEKIVAG
YASRFIVIADFRKDSKNLGDRWHKGIPIEVIPMAYVPVSRAVAQKFGGEVELRMAVNKAG
PVVTDNGNFILDWKFDRVHKWSEVNTAIKMTPGVVDTGLFINMAERVYFGMQDGSVNVRE
KPF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgggcccttcagcaccctctacgggcgggtcctggccccactgcccggg
cgggccgggggcgcggcctcgggcgggggcgggaacaactggggcctctcgggttcccac
gtgcagttgccggggcgtgcacattcggagacccgcggcgacaagggaggctcgagcgcg
ggcggcccggccccctccacgatgtccaaggccgaggaggctaagaagctggcgagccac
acggcggtggagaaccacgtgaagaataaccaagtgctgggaattggaagtggttctaca
attgtccacgctgtgcagcgaatagctgaaagagtgaagcaagagaatctggacctcatc
tgcatccccacatctttccaggccaggcagcttatcttgcagtatggcttaaccctcagt
gacctggatcaacacccagagattgaccttgccatcgatggtgctgacgaagtggatgct
gagctcaatctcatcaagggtggaggaggctgcctgacccaggagaagatcgtggctggt
tatgcaagtcgtttcattgtgattgctgatttcaggaaagattcaaagaacctcggggat
cggtggcacaaggggattcccattgaagtcatcccaatggcctacgtcccagtgagccgg
gctgtggcccagaagtttgggggtgaggtggaacttcgaatggctgtcaacaaggcaggg
ccagtggtgacggataacgggaattttatcctggactggaagtttgaccgggtgcataaa
tggagtgaagtgaacacagctatcaaaatgactccaggcgtggtggacacaggccttttc
atcaacatggcagagagagtctactttgggatgcaggatggctcagtgaacgtgcgggag
aagcccttctag

DBGET integrated database retrieval system