KEGG   Mus musculus (mouse): 19895Help
Entry
19895             CDS       T01002                                 

Gene name
Rpia, RPI
Definition
(RefSeq) ribose 5-phosphate isomerase A
  KO
K01807  ribose 5-phosphate isomerase A [EC:5.3.1.6]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00030  Pentose phosphate pathway
mmu01100  Metabolic pathways
mmu01200  Carbon metabolism
mmu01230  Biosynthesis of amino acids
Module
mmu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
mmu_M00007  Pentose phosphate pathway, non-oxidative phase, fructose 6P => ribose 5P
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    19895 (Rpia)
Enzymes [BR:mmu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.6  ribose-5-phosphate isomerase
     19895 (Rpia)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Rib_5-P_isom_A Sugar-bind DeoRC SpoVS
Motif
Other DBs
NCBI-GeneID: 19895
NCBI-ProteinID: NP_033101
MGI: 103254
Ensembl: ENSMUSG00000053604
Vega: OTTMUSG00000022844
UniProt: P47968
Position
6 C1; 6 32.06 cM
AA seq 303 aa AA seqDB search
MQRPGPFSTLYGRVLAPLPGRAGGAASGGGGNNWGLSGSHVQLPGRAHSETRGDKGGSSA
GGPAPSTMSKAEEAKKLASHTAVENHVKNNQVLGIGSGSTIVHAVQRIAERVKQENLDLI
CIPTSFQARQLILQYGLTLSDLDQHPEIDLAIDGADEVDAELNLIKGGGGCLTQEKIVAG
YASRFIVIADFRKDSKNLGDRWHKGIPIEVIPMAYVPVSRAVAQKFGGEVELRMAVNKAG
PVVTDNGNFILDWKFDRVHKWSEVNTAIKMTPGVVDTGLFINMAERVYFGMQDGSVNVRE
KPF
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgccccgggcccttcagcaccctctacgggcgggtcctggccccactgcccggg
cgggccgggggcgcggcctcgggcgggggcgggaacaactggggcctctcgggttcccac
gtgcagttgccggggcgtgcacattcggagacccgcggcgacaagggaggctcgagcgcg
ggcggcccggccccctccacgatgtccaaggccgaggaggctaagaagctggcgagccac
acggcggtggagaaccacgtgaagaataaccaagtgctgggaattggaagtggttctaca
attgtccacgctgtgcagcgaatagctgaaagagtgaagcaagagaatctggacctcatc
tgcatccccacatctttccaggccaggcagcttatcttgcagtatggcttaaccctcagt
gacctggatcaacacccagagattgaccttgccatcgatggtgctgacgaagtggatgct
gagctcaatctcatcaagggtggaggaggctgcctgacccaggagaagatcgtggctggt
tatgcaagtcgtttcattgtgattgctgatttcaggaaagattcaaagaacctcggggat
cggtggcacaaggggattcccattgaagtcatcccaatggcctacgtcccagtgagccgg
gctgtggcccagaagtttgggggtgaggtggaacttcgaatggctgtcaacaaggcaggg
ccagtggtgacggataacgggaattttatcctggactggaagtttgaccgggtgcataaa
tggagtgaagtgaacacagctatcaaaatgactccaggcgtggtggacacaggccttttc
atcaacatggcagagagagtctactttgggatgcaggatggctcagtgaacgtgcgggag
aagcccttctag

DBGET integrated database retrieval system