KEGG   Mus musculus (mouse): 20183Help
Entry
20183             CDS       T01002                                 

Gene name
Rxrg, Nr2b3
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  
retinoid X receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
PPAR signaling pathway
Thyroid hormone signaling pathway
Adipocytokine signaling pathway
Pathways in cancer
Transcriptional misregulation in cancer
Thyroid cancer
Small cell lung cancer
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Endocrine system
   04920 Adipocytokine signaling pathway
    20183 (Rxrg)
   03320 PPAR signaling pathway
    20183 (Rxrg)
   04919 Thyroid hormone signaling pathway
    20183 (Rxrg)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    20183 (Rxrg)
   05202 Transcriptional misregulation in cancers
    20183 (Rxrg)
   05216 Thyroid cancer
    20183 (Rxrg)
   05222 Small cell lung cancer
    20183 (Rxrg)
   05223 Non-small cell lung cancer
    20183 (Rxrg)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    20183 (Rxrg)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   20183 (Rxrg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
1 H2.3; 1 74.99 cM
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERIL
EAELAVEPKTESYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattattcccacttcatgaagtttcccaccggctttggtggctcccctggt
cacactggctcgacgtccatgagcccttcagtagccttgcccacggggaagccaatggac
agccaccccagctacacagacaccccagtgagtgcccctcggacgctgagtgctgtggga
acccccctcaatgctcttggctctccgtatagagtcatcacttctgccatgggtccaccc
tcaggagcactggcagctcctccaggaatcaacttggtggctccacccagctcccagcta
aatgtggtcaacagtgtcagcagctctgaggacatcaagcccttaccaggtctgcctggg
attggaaatatgaactacccatccaccagccctgggtctctggtgaaacacatctgtgcc
atctgtggggacagatcctcagggaagcactacggtgtgtacagctgtgaaggttgcaaa
ggcttcttcaaaaggaccatcaggaaagatctcatctacacctgtcgggataacaaagat
tgtctcatcgacaagcgccagcgcaaccgctgccagtactgtcgctaccagaagtgcctg
gtcatgggcatgaagcgggaagctgtgcaagaagaaaggcagaggagccgagagcgagca
gagagtgaggcagaatgtgccagtagtagccacgaagacatgcccgtggagaggattcta
gaagccgaacttgctgtggaaccaaagacagaatcctacggtgacatgaacgtggagaac
tcaacaaatgaccctgttaccaacatatgccatgctgcagataagcaacttttcaccctc
gttgagtgggccaaacgcatcccccacttctcagatctcaccttggaggaccaggtcatt
ctactccgggcagggtggaatgaactgctcattgcctccttctcccaccgctcggtttcc
gtccaggatggcatcctgctggccacgggcctccacgtgcacaggagcagcgctcacagc
gcgggagtcggctccatcttcgacagagtccttacagagttggtgtccaagatgaaagac
atgcagatggataagtcagagctggggtgcctacgggccatcgtgctgtttaacccagat
gccaagggtttatccaacccctctgaggtggagactcttcgagagaaggtttatgccacc
ctggaggcctataccaagcagaagtatccggaacagccaggcaggtttgccaagcttctg
ctgcgtctccctgctctgcgctccatcggcttgaaatgcctggaacacctcttcttcttc
aagctcattggagacactcccatcgacagcttcctcatggagatgttggagaccccactg
cagatcacctga

DBGET integrated database retrieval system