KEGG   Mus musculus (mouse): 20183Help
Entry
20183             CDS       T01002                                 

Gene name
Rxrg, Nr2b3
Definition
(RefSeq) retinoid X receptor gamma
  KO
K08526  retinoid X receptor gamma
Organism
mmu  Mus musculus (mouse)
Pathway
mmu03320  PPAR signaling pathway
mmu04659  Th17 cell differentiation
mmu04919  Thyroid hormone signaling pathway
mmu04920  Adipocytokine signaling pathway
mmu04928  Parathyroid hormone synthesis, secretion and action
mmu05200  Pathways in cancer
mmu05202  Transcriptional misregulation in cancer
mmu05216  Thyroid cancer
mmu05222  Small cell lung cancer
mmu05223  Non-small cell lung cancer
mmu05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Immune system
   04659 Th17 cell differentiation
    20183 (Rxrg)
  Endocrine system
   04920 Adipocytokine signaling pathway
    20183 (Rxrg)
   03320 PPAR signaling pathway
    20183 (Rxrg)
   04919 Thyroid hormone signaling pathway
    20183 (Rxrg)
   04928 Parathyroid hormone synthesis, secretion and action
    20183 (Rxrg)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    20183 (Rxrg)
   05202 Transcriptional misregulation in cancers
    20183 (Rxrg)
   05226 Gastric cancer
    20183 (Rxrg)
   05216 Thyroid cancer
    20183 (Rxrg)
   05222 Small cell lung cancer
    20183 (Rxrg)
   05223 Non-small cell lung cancer
    20183 (Rxrg)
Transcription factors [BR:mmu03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    20183 (Rxrg)
Nuclear receptors [BR:mmu03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   20183 (Rxrg)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 20183
NCBI-ProteinID: NP_033133
MGI: 98216
Ensembl: ENSMUSG00000015843
Vega: OTTMUSG00000022560
UniProt: P28705
Position
1 H2.3; 1 74.99 cM
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPTGFGGSPGHTGSTSMSPSVALPTGKPMDSHPSYTDTPVSAPRTLSAVG
TPLNALGSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLIYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSSHEDMPVERIL
EAELAVEPKTESYGDMNVENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKSELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDSFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatggaaattattcccacttcatgaagtttcccaccggctttggtggctcccctggt
cacactggctcgacgtccatgagcccttcagtagccttgcccacggggaagccaatggac
agccaccccagctacacagacaccccagtgagtgcccctcggacgctgagtgctgtggga
acccccctcaatgctcttggctctccgtatagagtcatcacttctgccatgggtccaccc
tcaggagcactggcagctcctccaggaatcaacttggtggctccacccagctcccagcta
aatgtggtcaacagtgtcagcagctctgaggacatcaagcccttaccaggtctgcctggg
attggaaatatgaactacccatccaccagccctgggtctctggtgaaacacatctgtgcc
atctgtggggacagatcctcagggaagcactacggtgtgtacagctgtgaaggttgcaaa
ggcttcttcaaaaggaccatcaggaaagatctcatctacacctgtcgggataacaaagat
tgtctcatcgacaagcgccagcgcaaccgctgccagtactgtcgctaccagaagtgcctg
gtcatgggcatgaagcgggaagctgtgcaagaagaaaggcagaggagccgagagcgagca
gagagtgaggcagaatgtgccagtagtagccacgaagacatgcccgtggagaggattcta
gaagccgaacttgctgtggaaccaaagacagaatcctacggtgacatgaacgtggagaac
tcaacaaatgaccctgttaccaacatatgccatgctgcagataagcaacttttcaccctc
gttgagtgggccaaacgcatcccccacttctcagatctcaccttggaggaccaggtcatt
ctactccgggcagggtggaatgaactgctcattgcctccttctcccaccgctcggtttcc
gtccaggatggcatcctgctggccacgggcctccacgtgcacaggagcagcgctcacagc
gcgggagtcggctccatcttcgacagagtccttacagagttggtgtccaagatgaaagac
atgcagatggataagtcagagctggggtgcctacgggccatcgtgctgtttaacccagat
gccaagggtttatccaacccctctgaggtggagactcttcgagagaaggtttatgccacc
ctggaggcctataccaagcagaagtatccggaacagccaggcaggtttgccaagcttctg
ctgcgtctccctgctctgcgctccatcggcttgaaatgcctggaacacctcttcttcttc
aagctcattggagacactcccatcgacagcttcctcatggagatgttggagaccccactg
cagatcacctga

DBGET integrated database retrieval system