KEGG   Mus musculus (mouse): 20194Help
Entry
20194             CDS       T01002                                 

Gene name
S100a10, 42C, AA409961, AL024248, CAL12, CLP11, Cal1l, p10, p11
Definition
(RefSeq) S100 calcium binding protein A10 (calpactin)
  KO
K17274  
calpactin-1 light chain
Organism
mmu  Mus musculus (mouse)
Brite
Exosome [BR:mmu04147]
 Exosomal proteins
  Exosomal proteins of microglial cells
   20194 (S100a10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
3 40.51 cM; 3 F1-F2
AA seq 97 aa AA seqDB search
MPSQMEHAMETMMLTFHRFAGDKDHLTKEDLRVLMEREFPGFLENQKDPLAVDKIMKDLD
QCRDGKVGFQSFLSLVAGLTIACNDYFVVNMKQKGKK
NT seq 294 nt NT seq  +upstreamnt  +downstreamnt
atgccatcccaaatggagcacgccatggaaaccatgatgcttacgtttcacaggtttgca
ggcgacaaagaccacttgacaaaggaggacctgagagtgctcatggaacgggagttccct
gggtttttggaaaatcaaaaggaccctctggctgtggacaaaataatgaaggacctggac
cagtgccgagatggcaaagtgggcttccagagctttctatcactagtggcagggctcacc
attgcatgcaatgactattttgtagtaaacatgaagcagaaggggaagaagtag

DBGET integrated database retrieval system