KEGG   Mus musculus (mouse): 20249Help
Entry
20249             CDS       T01002                                 

Gene name
Scd1, AA589638, AI265570, Scd, Scd-1, ab
Definition
stearoyl-Coenzyme A desaturase 1 (EC:1.14.19.1)
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mmu  Mus musculus (mouse)
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
PPAR signaling pathway
AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    20249 (Scd1)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    20249 (Scd1)
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    20249 (Scd1)
 Organismal Systems
  Endocrine system
   03320 PPAR signaling pathway
    20249 (Scd1)
Enzymes [BR:mmu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     20249 (Scd1)
Lipid biosynthesis proteins [BR:mmu01004]
 Desaturase
  First
   20249 (Scd1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
MGI: 
Ensembl: 
UniProt: 
Position
19 C3; 19 37.98 cM
AA seq 355 aa AA seqDB search
MPAHMLQEISSSYTTTTTITAPPSGNEREKVKTVPLHLEEDIRPEMKEDIHDPTYQDEEG
PPPKLEYVWRNIILMVLLHLGGLYGIILVPSCKLYTCLFGIFYYMTSALGITAGAHRLWS
HRTYKARLPLRIFLIIANTMAFQNDVYEWARDHRAHHKFSETHADPHNSRRGFFFSHVGW
LLVRKHPAVKEKGGKLDMSDLKAEKLVMFQRRYYKPGLLLMCFILPTLVPWYCWGETFVN
SLFVSTFLRYTLVLNATWLVNSAAHLYGYRPYDKNIQSRENILVSLGAVGEGFHNYHHTF
PFDYSASEYRWHINFTTFFIDCMAALGLAYDRKKVSKATVLARIKRTGDGSHKSS
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgccggcccacatgctccaagagatctccagttcttacacgaccaccaccaccatcact
gcacctccctccggaaatgaacgagagaaggtgaagacggtgcccctccacctggaagaa
gacatccgtcctgaaatgaaagaagatattcacgaccccacctatcaggatgaggaggga
cccccgcccaagctggagtacgtctggaggaacatcattctcatggtcctgctgcacttg
ggaggcctgtacgggatcatactggttccctcctgcaagctctacacctgcctcttcggg
attttctactacatgaccagcgctctgggcatcacagccggggctcatcgcctctggagc
cacagaacttacaaggcacggctgcccctgcggatcttccttatcattgccaacaccatg
gcgttccagaatgacgtgtacgaatgggcccgagatcaccgcgcccaccacaagttctca
gaaacacacgccgaccctcacaattcccgccgtggcttcttcttctctcacgtgggttgg
ctgcttgtgcgcaaacacccggctgtcaaagagaagggcggaaaactggacatgtctgac
ctgaaagccgagaagctggtgatgttccagaggaggtactacaagcccggcctcctgctg
atgtgcttcatcctgcccacgctggtgccctggtactgctggggcgagacttttgtaaac
agcctgttcgttagcaccttcttgcgatacactctggtgctcaacgccacctggctggtg
aacagtgccgcgcatctctatggatatcgcccctacgacaagaacattcaatcccgggag
aatatcctggtttccctgggtgccgtgggcgagggcttccacaactaccaccacaccttc
cccttcgactactctgccagtgagtaccgctggcacatcaacttcaccacgttcttcatc
gactgcatggctgccctgggcctggcttacgaccggaagaaagtttctaaggctactgtc
ttagccaggattaagagaactggagacgggagtcacaagagtagctga

DBGET integrated database retrieval system