KEGG   Mus musculus (mouse): 20262Help
Entry
20262             CDS       T01002                                 

Gene name
Stmn3, 9330161A03Rik, AI604839, R75323, Sclip
Definition
(RefSeq) stathmin-like 3
Organism
mmu  Mus musculus (mouse)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2; 2 H4
AA seq 180 aa AA seqDB search
MASTVSAYKEKMKELSVLSLICSCFYSQPHPNTIYQYGDMEVKQLDKRASGQSFEVILKS
PSDLSPESPVLSSPPKRKDASLEELQKRLEAAEERRKTQEAQVLKQLAERREHEREVLHK
ALEENNNFSRLAEEKLNYKMELSKEIREAHLAALRERLREKELHAAEVRRNKEQREEMSG
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggccagcaccgtatctgcctacaaggagaagatgaaggagttatctgtgctgtcgctc
atttgctcctgcttctactctcagcctcacccgaacaccatctaccagtatggagatatg
gaagtgaagcagctggataagcgggcctctggccagagcttcgaggtcatcctcaagtct
ccttctgacctatctccagagagccctgtgctctcttctcctcccaagaggaaggatgct
tccttggaagagctgcagaagcggctggaggcagctgaggagcggaggaagactcaggag
gctcaggtgctgaagcagctggcagagcggcgtgagcatgaacgggaggtgctgcacaag
gcgcttgaagaaaacaataactttagccgcctggcggaggagaagctcaactacaagatg
gagctgagcaaggagatccgcgaggcgcacttggcagcgctgcgcgagcggctgcgcgag
aaggagctgcacgctgctgaggtgcgcaggaacaaggagcagcgggaggaaatgtctggc
taa

DBGET integrated database retrieval system