KEGG   Mus musculus (mouse): 20269Help
Entry
20269             CDS       T01002                                 

Gene name
Scn3a, Gm1000, Nav1.3
Definition
(RefSeq) sodium channel, voltage-gated, type III, alpha
  KO
K04836  
voltage-gated sodium channel type III alpha
Organism
mmu  Mus musculus (mouse)
Pathway
Taste transduction
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Organismal Systems
  Sensory system
   04742 Taste transduction
    20269 (Scn3a)
Ion channels [BR:mmu04040]
 Voltage-gated cation channels
  Na+ channel, SCN alpha, NaV1.x
   20269 (Scn3a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
MGI: 
Ensembl: 
Vega: 
UniProt: 
Position
2 C1.3; 2 38.55 cM
AA seq 1947 aa AA seqDB search
MAQALLVPPGPESFRLFTRESLAAIEKRAAEEKAKKPKKEQDIDDENKPKPNSDLEAGKN
LPFIYGDIPPEMVSEPLEDLDPYYVSKKTFVVLNKGKAIFRFSATSALYILTPLNPVRKI
AIKILVHSLFSMLIMCTILTNCVFMTLSNPPDWTKNVEYTFTGIYTFESLIKILARGFCL
EDFTFLRDPWNWLDFSVIVMAYVTEFVDLGNVSALRTFRVLRALKTISVIPGLKTIVGAL
IQSVKKLSDVMILTVFCLSVFALIGLQLFMGNLRNKCLQWPPSDSAFEINTTSYFNGTMD
SNGTFVNVTMSTFNWKDYIADDSHFYVLDGQKDPLLCGNGSDAGQCPEGYICVKAGRNPN
YGYTSFDTFSWAFLSLFRLMTQDYWENLYQLTLRAAGKTYMIFFVLVIFLGSFYLVNLIL
AVVAMAYEEQNQATLEEAEQKEAEFQQMLEQLKKQQEEAQAVAAASAASRDFSGIGGLGE
LLESSSEASKLSSKSAKEWRNRRKKRRQREHLEGNHRPEGDRFPKSESEDSVKRRSFLFS
LDGNPLSGDKKLCSPHQSLLSIRGSLFSPRRNSKTSIFSFRGRAKDVGSENDFADDEHST
FEDSESRRDSLFVPHRPGERRNSNGTTTETEVRKRRLSSYQISMEMLEDSSGRQRAMSIA
SILTNTMEELEESRQKCPPCWYRFANVFLIWDCCDSWLKVKHLVNLIVMDPFVDLAITIC
IVLNTLFMAMEHYPMTEQFSSVLTVGNLVFTGIFTAEMVLKIIAMDPYYYFQEGWNIFDG
IIVSLSLMELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNMLIKIIGNSVGALGNLTLVL
AIIVFIFAVVGMQLFGKSYKECVCKINEDCKLPRWHMNDFFHSFLIVFRVLCGEWIETMW
DCMEVAGQTMCLIVFMLVMVIGNLVVLNLFLALLLSSFSSDNLAATDDDNEMNNLQIAVG
RMQKGIDYVKNKIRECFRKAFFRKPKVIEIHEGNKIDSCMSNNTGVVEISKELNYLKDGN
GTTSGVGTGSSVEKYVIDENDYMSFINNPSLTVTVPIAVGESDFENLNTEEFSSESELEE
SKEKLNATSSSEGSTVDVAPPREGEQAEIEPEEDLKPEACFTEGCIKKFPFCQVSTEEGK
GKIWWNLRKTCYSIVEHNWFETFIVFMILLSSGALAFEDIYIEQRKTIKTMLEYADKVFT
YIFILEMLLKWVAYGFQTYFTNAWCWLDFLIVDVSLVSLVANALGYSELGAIKSLRTLRA
LRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLIFSIMGVNLFAGKFYHCVNMT
TGSMFDMSEVNNFSDCQALGKQARWKNVKVNFDNVGAGYLALLQVATFKGWMDIMYAAVD
SRDVKLQPVYEENLYMYLYFVIFIIFGSFFTLNLFIGVIIDNFNQQKKKFGGQDIFMTEE
QKKYYNAMKKLGSKKPQKPIPRPANKFQGMVFDFVTRQVFDISIMILICLNMVTMMVETD
DQSKYMTLVLSRINLVFIVLFTGEFLLKLISLRYYYFTIGWNIFDFVVVILSIVGMFLAE
LIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTLLFALMMSLPALFNIGLLLFLVMFI
YAIFGMSNFAYVKKEAGIDDMFNFETFGNSMICLFQITTSAGWDGLLAPILNSAPPDCDP
DAIHPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVNMYIAVILENFSVATEESAEPLSED
DFEMFYEVWEKFDPDATQFIEFCKLSDFAAALDPPLLIAKPNKVQLIAMDLPMVSGDRIH
CLDILFAFTKRVLGESGEMDALRIQMEDRFMASNPSKVSYEPITTTLKRKQEEVSAAIIQ
RNYRCYLLKQRLKNISNTYDKETIKGRIVLPIKGDMVIDKLNGNSTPEKTDGSSSTTSPP
SYDSVTKPDKEKFEKDKPEKESKGKEV
NT seq 5844 nt NT seq  +upstreamnt  +downstreamnt
atggcccaggcactgctggtacccccgggacctgagagcttccgccttttcactcgagaa
tctcttgctgctatcgaaaagcgtgctgcagaagagaaagccaagaaacccaagaaagaa
caagacattgacgatgagaacaagccaaagccaaacagtgacttggaagctgggaagaac
cttccatttatctatggagacattcctccagagatggtgtcggagcctctggaggacctg
gacccctactacgtcagtaagaaaacttttgtagtgttgaataaagggaaggcaattttt
cgattcagtgccacctccgccttgtatattttaactccactaaaccccgttaggaaaatt
gctattaagattttggtacactctttattcagcatgcttatcatgtgcactattttgacc
aactgtgtatttatgacattgagcaatcctcctgactggacgaagaatgtagagtacaca
ttcactgggatctatacctttgagtcacttataaagatcttggccagaggattctgctta
gaagatttcacatttcttcgtgacccatggaactggctggatttcagtgtcatcgtgatg
gcatatgtgacagagtttgtggacctgggcaatgtctcagcgctgagaacgttcagagtt
ctccgagcattgaaaacaatatcagtcattccaggtttaaagaccatcgtgggggccctg
atccagtcggtgaagaagctgtctgacgtcatgatactcactgtgttctgtctgagcgtc
tttgctctcatcgggctgcagctcttcatgggcaacctgaggaataaatgcttgcagtgg
cctccaagcgattctgcttttgagatcaacactacttcctacttcaatggcacaatggac
tcaaatgggacatttgttaatgtaacaatgagcacattcaactggaaggactatatcgca
gatgacagccacttttatgttttggatggacaaaaagatcctttactttgtggaaatggg
tccgatgcaggacaatgtccagaagggtacatctgtgtgaaggctggacgaaaccccaac
tacggttacacgagctttgacacatttagctgggccttcttatcgctgtttcgactcatg
actcaagactactgggagaacctttaccagttgacattacgtgcagctgggaaaacctac
atgatctttttcgtcctggtaattttcttgggctcattttatttggtgaacttgatcctg
gctgtggtggccatggcctatgaggaacaaaatcaggccacactggaggaggctgagcag
aaagaggcggagtttcagcagatgttggagcagttgaaaaagcagcaagaggaggctcag
gcggtggcagctgcctcagcagcgtccagagacttcagtgggataggagggttaggagaa
cttctggagagttcttcagaagcttccaagttgagctccaagagtgccaaggagtggagg
aatcggaggaagaagaggagacagagggagcacttggagggaaaccacagacccgaagga
gacaggtttcccaagtcggaatcagaagacagcgtcaagcgaaggagtttcctgttctcc
ctggatgggaacccgctgagcggcgacaagaagctgtgctctccccatcagtctctcttg
agtatccgtggctccctgttttccccaagacgcaatagcaaaacgagcattttcagcttc
agaggtcgggcgaaggacgtggggtctgagaatgactttgcggatgatgaacacagcacc
tttgaagatagcgagagcaggagagactcactgtttgtgccgcacagacctggagagcga
cgcaacagtaacggtaccaccactgaaacagaagtcaggaagagaaggctaagttcttac
cagatctcgatggaaatgctggaggattcctctgggagacaaagagccatgagcatagcc
agtatcctgaccaacacgatggaggaacttgaagaatctagacagaagtgtccaccatgc
tggtatagatttgccaatgtgtttttgatctgggactgttgtgattcatggttgaaagta
aagcatcttgtgaatttgattgtgatggatccatttgttgacctggccatcaccatctgc
atcgtgttaaacacactgttcatggccatggagcactacccgatgacggagcagttcagc
agtgtgctgacggtgggaaacctggtcttcaccgggatcttcacagccgagatggtcctg
aaaatcatcgcaatggatccctattactatttccaagagggctggaatatctttgatgga
attattgttagcctgagtttaatggagcttggcctggcaaacgtggaggggctgtccgtg
cttcggtccttcagactgctgcgagtcttcaagttggcaaaatcctggcccacactgaat
atgctcattaagatcatcggcaactcggtgggcgcactgggcaacctgaccctggtgctg
gccatcatcgtcttcatttttgccgtggtcggcatgcagctgtttggaaagagctacaag
gagtgtgtttgcaagatcaatgaggactgcaagctcccgcgctggcacatgaacgacttc
ttccactccttcctgatagtgttccgcgtgctgtgtggggagtggatagagaccatgtgg
gactgcatggaggtcgcgggccagaccatgtgccttattgtgtttatgttggtcatggtg
attgggaaccttgtggttctgaacctcttcctggccttattgttgagttcctttagttca
gacaaccttgctgctacggacgatgataacgaaatgaacaacctccagatcgcggtggga
aggatgcaaaaggggattgattatgtgaaaaataagatacgggagtgcttccgaaaagcg
ttttttagaaagccgaaagtgatagaaatccacgaagggaacaaaatagacagctgcatg
tccaataacacgggcgtagttgaaataagcaaagagcttaactaccttaaagacggtaac
ggaaccaccagtggcgtgggtactggaagcagtgtggagaaatacgtaattgatgaaaat
gactacatgtcattcatcaacaaccccagcctcaccgtgacggtgccaattgccgtggga
gagtctgactttgaaaatttaaacacggaagagtttagcagtgagtcagaactggaagaa
agcaaggagaaattaaatgcaaccagctcttctgaaggaagcacagttgacgttgctccg
ccccgagaaggtgaacaagctgaaattgaacctgaggaggaccttaagccagaagcttgc
tttactgaaggatgcattaaaaaatttcccttctgccaagtaagtacggaagaaggtaaa
ggaaaaatctggtggaatcttaggaagacctgctatagcattgtggaacacaactggttt
gagacgttcattgtgttcatgattctcctcagtagtggtgctttggcctttgaagatata
tacattgagcaacggaagaccatcaaaaccatgctggagtatgctgacaaagtcttcact
tacatcttcatcctggaaatgctcctcaaatgggtggcctatggatttcaaacctatttc
accaatgcctggtgctggttggacttcttgattgttgatgtttctttggttagcctggtg
gccaacgctcttggctattcagaacttggtgccatcaaatccctacggaccctgagagct
ctgaggccgctccgagccttatcccgctttgaaggcatgagggtggttgtgaacgctctt
gttggtgcaatcccctccatcatgaatgtgctactggtgtgcctcatcttctggttaatc
tttagtatcatgggtgtgaatctgtttgctggaaagttctatcactgtgttaacatgaca
acgggcagcatgttcgacatgagtgaagtcaacaatttcagcgactgtcaggctcttggc
aagcaagcccgatggaagaatgtgaaagtcaactttgacaatgttggggctggctacctg
gcattgctgcaagtggccacattcaaaggctggatggatattatgtatgcagctgtggat
tcacgggacgtcaaactgcagcctgtatatgaagaaaatctgtacatgtatctgtacttt
gtcatcttcatcatctttgggtcgttcttcactctaaatctattcatcggcgtcatcata
gacaacttcaaccagcagaagaagaagtttggaggtcaagacatctttatgacagaagag
cagaaaaagtactacaatgcaatgaagaaacttggctccaaaaaacctcagaagcccatc
cctcgacctgcaaacaaatttcaaggaatggtctttgactttgtaaccagacaagtgttt
gacatcagcatcatgatcctcatctgcctcaacatggtgaccatgatggtggaaacggac
gaccagagcaaatacatgaccctggttttgtcccgaatcaacctggtattcatcgtcctc
ttcactggggagtttctgctgaagctcatctctctcagatactactacttcacgattggc
tggaacatctttgactttgtggtggtgattctctcaattgtaggaatgttccttgctgag
ctgatagagaagtattttgtgtctcctaccctgttccgagtcatccgcctggccaggatt
ggacgaatcctacgcctgatcaaaggcgccaaggggatccgcacgctgctctttgctctg
atgatgtcccttcctgcgctgttcaacatcggcctcctgcttttcctcgtcatgttcatc
tacgccatctttgggatgtccaactttgcctatgttaaaaaagaggctggaattgatgac
atgttcaactttgagacttttggcaacagcatgatctgcctgttccaaatcaccacctct
gcgggctgggatggactgttggcccccatcctcaacagtgcacctcctgactgtgaccct
gatgcaattcaccctggaagctcagtgaagggagactgtgggaacccatctgtggggatt
ttcttttttgtcagctacatcatcatatccttcctggttgtggtgaacatgtacattgct
gtcatcctggagaacttcagcgttgccacagaagaaagtgcagagcccctgagtgaggac
gactttgagatgttctacgaggtctgggagaagttcgaccctgacgccacccagttcata
gagttctgcaagctctctgactttgcagctgccctggatcctcccctcctcatcgcaaag
ccaaacaaagtccagctcattgccatggacctgcccatggtgagtggagaccgcatccac
tgcctggacatcttatttgcttttacaaagcgggtcctgggtgagagtggagagatggat
gcccttcgaatccagatggaagatcggttcatggcttccaatccctccaaggtctcttat
gagcccattaccaccactctgaagcgcaaacaagaggaggtgtctgctgctatcattcag
cgtaattacagatgttatcttttaaagcaaaggttaaaaaacatatcaaatacgtatgac
aaagagacaatcaaggggaggattgtcttgcctataaaaggagatatggttattgacaaa
ttaaatgggaattccaccccagaaaagacagatgggagttcctctaccacctctcctcct
tcctatgacagtgtaacaaaaccagataaggaaaagtttgagaaagacaaaccagaaaaa
gaaagcaaagggaaagaggtctga

DBGET integrated database retrieval system