KEGG   Mus musculus (mouse): 20397Help
Entry
20397             CDS       T01002                                 

Gene name
Sgpl1, AI428538, D10Xrf456, S1PL, Spl
Definition
(RefSeq) sphingosine phosphate lyase 1
  KO
K01634  sphinganine-1-phosphate aldolase [EC:4.1.2.27]
Organism
mmu  Mus musculus (mouse)
Pathway
mmu00600  Sphingolipid metabolism
mmu01100  Metabolic pathways
mmu04071  Sphingolipid signaling pathway
Module
mmu_M00100  Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:mmu00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    20397 (Sgpl1)
 Environmental Information Processing
  Signal transduction
   04071 Sphingolipid signaling pathway
    20397 (Sgpl1)
Enzymes [BR:mmu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.27  sphinganine-1-phosphate aldolase
     20397 (Sgpl1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 Aminotran_1_2 DegT_DnrJ_EryC1 SepSecS Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 20397
NCBI-ProteinID: NP_001303602
MGI: 1261415
Ensembl: ENSMUSG00000020097
Vega: OTTMUSG00000031946
UniProt: Q8R0X7
Position
10 B4; 10 32.14 cM
AA seq 568 aa AA seqDB search
MPGTDLLKLKDFEPYLEILESYSTKAKNYVNGYCTKYEPWQLIAWSVLCTLLIVWVYELI
FQPESLWSRFKKKLFKLIRKMPFIGRKIEQQVSKAKKDLVKNMPFLKVDKDYVKTLPAQG
MGTAEVLERLKEYSSMDGSWQEGKASGAVYNGEPKLTELLVQAYGEFTWSNPLHPDIFPG
LRKLEAEIVRMTCSLFNGGPDSCGCVTSGGTESILMACKAYRDLALEKGIKTPEIVAPES
AHAAFDKAAHYFGMKIVRVALKKNMEVDVQAMKRAISRNTAMLVCSTPQFPHGVMDPVPE
VAKLAVRYKIPLHVDACLGGFLIVFMEKAGYPLEKPFDFRVKGVTSISADTHKYGYAPKG
SSVVMYSNEKYRTYQFFVGADWQGGVYASPSIAGSRPGGIIAACWAALMHFGENGYVEAT
KQIIKTARFLKSELENIKNIFIFGDPQLSVIALGSNDFDIYRLSNMMSAKGWNFNYLQFP
RSIHFCITLVHTRKRVAIQFLKDIRESVTQIMKNPKAKTTGMGAIYGMAQATIDRKLVAE
ISSVFLDCLYTTDPVTQGNQMNGSPKPR
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgcccggaaccgacctcctcaagctgaaggacttcgagccttatttggagattttggaa
tcatattccacaaaagccaagaattatgtgaatggatattgcaccaaatatgagccctgg
cagctcattgcgtggagtgtcctgtgtactctgctgatagtctgggtgtatgagcttatc
ttccagccagagagtttatggtctcggtttaaaaaaaaattatttaagcttatcaggaag
atgccatttattggacgtaagatcgaacaacaggtgagcaaagccaagaaggatcttgtc
aagaacatgccattcctaaaggtggacaaggattatgtgaaaactctgcctgctcagggt
atgggcacagctgaggttctggagagactcaaggagtacagctccatggatggttcctgg
caagaagggaaagcctcaggagctgtgtacaatggggaaccgaagctcacggagctgctg
gtgcaggcttatggagaattcacgtggagcaatccactgcatccagatatcttccctgga
ttgcggaagttagaggcagaaatcgttaggatgacttgttccctcttcaatgggggacca
gattcctgtggatgtgtgacttctgggggaacggaaagcatcctgatggcctgcaaagct
taccgggacttggcgttagagaaggggatcaaaactccagaaattgtggctcccgagagt
gcccatgctgcattcgacaaagcagctcattattttgggatgaagattgtccgagttgca
ctgaaaaagaacatggaggtggatgtgcaggcaatgaagagagccatctccaggaacaca
gctatgctggtctgttctaccccacagtttcctcatggtgtgatggatcctgtccccgaa
gtggccaagttggctgtcagatataaaatcccactccatgtggatgcttgtctggggggc
ttcctcattgtcttcatggagaaagcagggtacccactggagaaaccatttgatttccgg
gtgaaaggtgtgaccagcatttcagcagatactcataagtatggctatgctcctaaaggt
tcatcagtggtgatgtactctaacgagaagtacaggacgtaccagttctttgttggtgca
gactggcaaggtggtgtctacgcatctccaagcatagctggctcacggcctggtggcatc
attgcagcctgttgggccgccttgatgcacttcggtgagaacggctatgttgaagctacc
aaacagatcatcaaaactgctcgcttcctgaagtcagaactggaaaacatcaaaaacatc
ttcattttcggtgatcctcaattgtcagttattgctctgggatccaacgattttgacatt
taccgactatctaatatgatgtctgctaaggggtggaattttaactacctgcagttccca
agaagcattcatttctgcattacgttagtacatactcggaagcgagtggcgatccagttc
ctaaaggatatccgggaatcagtcacacaaatcatgaagaatcctaaagctaagaccaca
ggaatgggtgccatctatggcatggcccaggcaaccattgacaggaagctggttgcagaa
atatcctccgtcttcttggactgcctttatactacggaccccgtgactcagggcaaccag
atgaacggttctccaaagccccgctga

DBGET integrated database retrieval system